KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344045
Entry
4344045           CDS       T01015                                 
Name
(RefSeq) 1-Cys peroxiredoxin A
  KO
K11188  peroxiredoxin 6 [EC:1.11.1.7 1.11.1.27 3.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4344045
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4344045
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     4344045
    1.11.1.27  glutathione-dependent peroxiredoxin
     4344045
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-
     4344045
SSDB
Motif
Pfam: AhpC-TSA 1-cysPrx_C Redoxin AhpC-TSA_2 SCO1-SenC
Other DBs
NCBI-GeneID: 4344045
NCBI-ProteinID: XP_015645300
UniProt: P0C5C9 B7ERQ1 A0A8J8XYT7
LinkDB
Position
7:26548820..26550049
AA seq 220 aa
MPGLTIGDTVPNLELDSTHGKIRIHDFVGDTYVILFSHPGDFTPVCTTELAAMAGYAKEF
DKRGVKLLGISCDDVQSHKDWIKDIEAYKPGNRVTYPIMADPSREAIKQLNMVDPDEKDS
NGGHLPSRALHIVGPDKKVKLSFLYPACVGRNMDEVVRAVDALQTAAKHAVATPVNWKPG
ERVVIPPGVSDDEAKEKFPQGFDTADLPSGKGYLRFTKVG
NT seq 663 nt   +upstreamnt  +downstreamnt
atgccagggctcaccatcggcgacaccgtccccaacctggagctggactccacccacggc
aagatccgcatccacgacttcgtcggcgacacctatgtcatcctcttctcccaccccggc
gacttcaccccggtctgcaccacggagctggcagccatggccggctacgccaaggagttc
gacaagaggggcgtcaagctgctcggcatctcctgcgacgacgtgcagtctcacaaggac
tggatcaaggacatcgaggcctacaagcctgggaaccgcgtgacgtacccgatcatggcc
gatccgagccgcgaggccatcaagcagctgaacatggtcgacccggacgagaaggattcc
aacggcggccacctcccgtcccgcgcgctgcacatcgtcggccccgacaagaaggtgaag
ctgagcttcctgtacccggcgtgcgtggggcggaacatggatgaggtggtgcgtgcggtc
gacgcgctgcagacggcggcgaagcacgcggtggcgacgccggtgaactggaagcccggc
gagcgcgtcgtcatccctcccggcgtctccgacgacgaggcgaaggagaagttcccccag
gggttcgacaccgccgacctgccgtccggcaagggctacctccgcttcaccaaggtcggc
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344046
Entry
4344046           CDS       T01015                                 
Name
(RefSeq) 1-Cys peroxiredoxin B
  KO
K11188  peroxiredoxin 6 [EC:1.11.1.7 1.11.1.27 3.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4344046
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4344046
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     4344046
    1.11.1.27  glutathione-dependent peroxiredoxin
     4344046
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-
     4344046
SSDB
Motif
Pfam: AhpC-TSA 1-cysPrx_C Redoxin AhpC-TSA_2 SCO1-SenC
Other DBs
NCBI-GeneID: 4344046
NCBI-ProteinID: XP_015645187
UniProt: P0C5D1
LinkDB
Position
7:26551667..26552983
AA seq 220 aa
MPGLTLGDVVPDLELDTTHGKIRLHDFVGDAYVIIFSHPADFTPVCTTELSEMAGYAGEF
DKRGVKLLGFSCDDVESHKDWIKDIEAYKPGRRVGFPIVADPDREAIRQLNMIDADEKDT
AGGELPNRALHIVGPDKKVKLSFLFPACTGRNMAEVLRATDALLTAARHRVATPVNWKPG
ERVVIPPGVSDEEAKARFPAGFETAQLPSNKCYLRFTQVD
NT seq 663 nt   +upstreamnt  +downstreamnt
atgcctggactcaccctcggcgacgtcgtccccgacctggagctcgacaccacccacggc
aagatccgcctccacgacttcgtcggcgacgcctacgtcatcatcttctcccaccccgct
gacttcacgccggtctgcacgacggagctgtcggagatggcgggctacgccggcgagttc
gacaagaggggcgtcaagctcctcggcttctcctgcgacgacgtcgagtcgcacaaggac
tggatcaaggacatcgaggcctacaagcctggccgccgcgtcggcttcccgatcgtcgcc
gacccggacagggaggcgatcaggcagctcaacatgatcgacgccgacgagaaggacacc
gccggcggcgagctccccaaccgggcgctccacatcgtcgggccggacaagaaggtgaag
ctgagcttcctgttcccggcgtgcacggggcggaacatggcggaggtgctgcgcgcgacg
gacgcgctgctgacggcggcgaggcaccgggtggcgacgccggtgaactggaagcccggc
gagcgcgtcgtcatcccccccggcgtctccgacgaggaggccaaggcgaggttcccggcc
gggttcgagaccgcccagctgccctccaacaagtgctacctccgcttcacccaggtggac
tga

DBGET integrated database retrieval system