KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344164
Entry
4344164           CDS       T01015                                 
Name
(RefSeq) ferredoxin-dependent glutamate synthase, chloroplastic
  KO
K00284  glutamate synthase (ferredoxin) [EC:1.4.7.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4344164
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4344164
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4344164
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.7  With an iron-sulfur protein as acceptor
    1.4.7.1  glutamate synthase (ferredoxin)
     4344164
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C44
   4344164
SSDB
Motif
Pfam: GATase_2 Glu_synthase Glu_syn_central GXGXG FMN_dh
Other DBs
NCBI-GeneID: 4344164
NCBI-ProteinID: XP_015646712
UniProt: Q69RJ0
LinkDB
Position
7:complement(27723017..27738536)
AA seq 1615 aa
MATLPRAAAAAAPSPAAALLPLPRAAPLLAGRAAARSAARRLRARGTRAPPLAAARRGWG
GVSPRAVLDLPRRREAAEKPAQKAADLNEILSERGACGVGFVANLKNEPSFNIVRDALVA
LGCMEHRGGCGADNDSGDGSGLMSGIPWDLFNDWANKQGLAPLDRTNTGVGMVFLPQDEN
SMEEAKAVVAKVFTDEGLEVLGWRTVPFNVSVVGRYAKETMPNIQQIFVKVAKEDNADDI
ERELYICRKLIERATKSASWADELYFCSLSSRTIVYKGMLRSEILGQFYLDLQNELYKSP
FAIYHRRYSTNTSPRWPLAQPMRLLGHNGEINTIQGNLNWMRSREATLQSPVWRGREHEI
RPFGDPKASDSANLDSTAELLLRSGRSPAEAMMILVPEAYKNHPTLSIKYPEVIDFYDYY
KGQMEAWDGPALLLFSDGRTVGACLDRNGLRPARYWRTSDDFVYVASEVGVIPMDESKVV
MKGRLGPGMMITVDLQTGQVLENTEVKKSVASANPYGSWLQQSTRSIKPVNFQSSVAMDN
ETVLRHQQAFGYSSEDVQMVIETMASQGKEPTFCMGDDIPLAVLSQKPHMLFDYFKQRFA
QVTNPAIDPLREGLVMSLEVNIGKRRNILEVGPENADQVTLSSPVLNEGELESLLNDSKL
KPKVLSTYFDIRKGLDGSLDKAIKVLCDEADAAVRNGSQLLVLSDRSEALEPTRPAIPIL
LAVGAIHQHLIQNGLRMSASIVADTAQCFSTHQFACLIGYGASAICPYLALETCRQWRLS
NKTVNLMRNGKMPTVTIEQAQRNFIKAVKSGLLKILSKMGISLLSSYCGAQIFEIYGLGQ
EVVDLAFCGSVSKIGGLTLDELGRETLSFWVKAFSEDTAKRLENFGFIQSRPGGEYHANN
PEMSKLLHKAVREKSDNAYTVYQQHLASRPVNVLRDLLELKSDRAPIPIGKVEPATSIVE
RFCTGGMSLGAISRETHEAIAIAMNRIGGKSNSGEGGEDPIRWSPLADVEDGYSPTLPHL
KGLQNGDTATSAIKQVASGRFGVTPTFLVNAEQIEIKIAQGAKPGEGGQLPGKKVSAYIA
RLRNSKPGVPLISPPPHHDIYSIEDLAQLIYDLHQINPKAKVSVKLVAEAGIGTVASGVS
KGNADIIQISGHDGGTGASPISSIKHAGGPWELGLSETHQTLIQNGLRERVVLRVDGGFR
SGLDVLMAAAMGADEYGFGSVAMIATGCVMARICHTNNCPVGVASQREELRARFPGVPGD
LVNYFLFVAEEVRATLAQLGFEKLDDIIGRTDILKAKHVSLAKTQHIDLKYLLSSAGLPK
WSSSQIRSQDVHSNGPVLDETILADPDISDAIENEKEVSKTFQIYNVDRAVCGRVAGVIA
KKYGDTGFAGQLNITFTGSAGQSFGCFLTPGMNIRLVGEANDYVGKGMAGGELVVVPVEK
TGFVPEDAAIVGNTCLYGATGGQVFVRGKTGERFAVRNSLGQAVVEGTGDHCCEYMTGGC
VVVLGKVGRNVAAGMTGGLAYILDEDDTLVPKVNKEIVKMQRVNAPAGQMQLKGLIEAYV
EKTGSEKGATILREWEAYLPLFWQLVPPSEEDSPEACAEFERVLAKQATTVQSAK
NT seq 4848 nt   +upstreamnt  +downstreamnt
atggccacgctcccacgtgcggcggcggcggcggcgccgtcgccagccgcggcgctgctc
ccgctcccgcgcgccgcgccgctgctggcggggcgcgcggcggcgcgctccgcggcgcgg
aggctcagggcgagggggacaagggcgccgccgctcgcggccgcgcggcgcgggtgggga
ggcgtctccccgcgcgcggtgctcgacctgccacgacgacgggaggccgcggagaagccc
gcgcagaaggctgcagatttgaatgaaatcttatcagaacgtggtgcttgtggtgttgga
tttgtcgcaaacttgaaaaatgagccttcattcaatattgtccgggatgcccttgtggct
cttggctgcatggagcaccgtggtgggtgtggagcggacaatgactccggtgacggttca
ggactgatgagtggtatcccatgggacttgttcaatgactgggccaacaagcaagggctt
gctcccctggacagaacaaatacaggtgtcggaatggtctttcttccacaagacgagaat
tctatggaagaagccaaagctgttgttgccaaggtattcactgacgaaggccttgaggtt
cttggctggagaactgttccttttaatgtatcagtggtaggtcgctatgcaaaagaaacc
atgcctaatatacaacagatatttgtgaaagttgcaaaagaagataatgctgatgacata
gagagagagttgtacatctgccggaagctgatagagcgggccacaaaatctgctagttgg
gcagatgaactttatttctgttctttgtcaagcagaactatagtctacaaggggatgctt
cgatctgagattcttgggcaattctatttggaccttcagaatgaactctacaaatcacct
tttgccatataccatcgaagatacagtaccaatacaagccctagatggcctcttgctcaa
cctatgaggttacttggacacaatggagagattaatacaatacaggggaacttgaactgg
atgcgatcaagggaagccacactacaatctcctgtatggcgtgggcgtgagcatgaaata
cgtccatttggtgatcctaaagcatctgattcagcaaaccttgacagtactgctgaatta
ctgctaagaagtggcagaagtcctgctgaagctatgatgattctcgttcctgaggcatac
aagaaccatcctacattgtcaataaaatatcctgaggtaatcgacttctatgactactat
aaaggtcaaatggaggcttgggatggacctgctttgctcttatttagtgatggaaggaca
gtaggagcatgtcttgatcgaaatggtctccgcccagcacgctattggagaacatctgat
gattttgtttatgttgcatctgaggttggtgttataccaatggatgagtcaaaggtagta
atgaaaggaagattgggtcctggaatgatgataacggttgacctacaaactggccaggtg
cttgaaaacacagaagtgaagaaaagtgtggcttcagcgaacccctatggatcctggttg
cagcaaagtacacgttcaataaagcctgtcaacttccagtcatctgttgctatggacaat
gaaacggtcttgagacaccagcaggcctttggatattcgagtgaagatgttcaaatggta
attgaaacaatggcttcacaaggcaaggaaccaacattttgtatgggtgacgacattcca
ttagctgtgttgtcacaaaagccacacatgttatttgattatttcaaacagcgatttgca
caagttacaaatcctgctattgatcccctcagagaaggtttggttatgtctcttgaagtc
aatattggtaaacggcgcaatatcttggaagttggccctgaaaatgctgatcaggttacc
ctatcaagtcctgtgcttaatgaaggtgaactagaatcacttttgaatgactcaaaactg
aagcctaaagtactctcgacatacttcgacatccgtaaaggtctagatggttcccttgat
aaggctattaaggttctttgtgatgaagctgatgctgctgtgcggaatggttctcaactt
cttgtgctttctgatcgttctgaagcactcgaaccaactcgccctgccatcccgatactt
ctagctgttggtgccatccaccagcatttgattcaaaatggtcttcggatgtctgcttcc
attgttgctgatactgctcagtgttttagcacccatcagtttgcttgcttgatcggatat
ggtgccagtgctatatgtccgtatctggcactagaaacatgccggcaatggaggctgagc
aacaaaactgttaatttgatgcgaaacgggaagatgcccacggtgaccattgagcaggcc
caaagaaactttatcaaggcagtaaaatctggcctactcaagattctttcaaaaatggga
atatcattgctctcaagttattgtggagcccagatcttcgaaatttatggccttggtcaa
gaggttgttgatctcgccttctgtggaagtgtatcgaaaattggaggtctcacccttgat
gagctgggtagagaaacattatcattctgggtgaaggcgttctcagaagatactgcgaag
aggctagagaactttggattcattcaatccagacctggaggtgaatatcatgcaaataat
cctgagatgtcaaagctgctgcacaaagcagttcgtgaaaaaagtgacaatgcatacacc
gtctaccaacaacatcttgcaagccgtcctgtcaatgttcttcgagatcttctagagttg
aagagtgatcgtgcccctattcctatcggtaaagttgagcctgcaacctccatcgttgag
cgattttgtacaggtggaatgtcccttggagctatttccagagaaacacatgaagctatt
gcaattgcaatgaatagaataggtgggaaatctaactccggagaaggtggtgaggaccca
atccgctggagtccccttgcagatgtagaggatgggtattctccaacacttcctcatctc
aagggtctacagaatggagacactgccacaagtgccattaagcaggttgcatctggacgc
tttggggttacaccaacatttttagtaaatgctgaacaaattgagataaagattgcacaa
ggggcaaagcctggtgaagggggccaacttccagggaaaaaagtcagtgcatacattgct
cggctgagaaactccaaacctggagttcctctcatatccccaccaccccaccatgacatc
tattcaatcgaggatctagcacagttaatttatgatcttcatcagatcaatccaaaagcg
aaggtatctgtaaagcttgtagctgaagcaggaattggaactgtagcttctggagtatcc
aaaggaaacgcagacataattcagatatcaggtcatgatggtggcactggagctagccca
attagttcaatcaagcatgctgggggtccttgggaacttggtctttcagaaacgcaccag
acacttatacaaaatggattgagagagagggtagtacttagggtggatggtggattcaga
agtggcctagatgtccttatggctgctgccatgggcgcggatgaatatggttttggttct
gtggctatgatagctactggatgtgtcatggcacgcatttgccacacaaacaattgccca
gttggagttgctagtcagagagaagaacttcgtgctaggtttcctggtgttcctggtgat
cttgtaaactacttcctctttgttgcagaagaggtacgagcgacattggcccaattgggt
tttgaaaagctcgatgatataattgggcgaacagatatacttaaagcaaagcatgtctct
ttggcgaaaacacagcacattgacctcaaatacctcttatcgagtgctggattacccaaa
tggagtagctctcagataaggagtcaagatgtccacagtaatggccctgttcttgacgag
acaatccttgccgatcctgatatatccgatgcgattgagaatgagaaggaggtttccaag
acatttcaaatttacaatgttgacagggctgtctgtggtcgagtagcaggtgtcattgcc
aagaagtatggtgacacaggatttgcaggccagctcaacattacgtttactggaagcgca
gggcagtcctttggatgtttcctaactcctggaatgaatattcggctagttggagaggcc
aacgattatgtgggaaagggtatggctggtggagagctggttgtagttcctgtagaaaaa
acaggatttgttcctgaggatgctgctatagttggtaacacttgtctgtatggagctact
ggtggtcaggtatttgtgagaggcaaaacaggtgaaagatttgcagttagaaactccctt
ggtcaagcagtggttgagggcactggagatcattgctgcgagtacatgactggtggctgt
gtagttgtacttggcaaagttgggaggaatgttgcagctggaatgacgggtggccttgcc
tatattctagatgaggatgatacactcgtcccaaaggttaacaaggagattgtgaagatg
cagagagtgaatgctccagccgggcagatgcagctgaagggcttgattgaggcttacgtt
gaaaaaacaggcagcgagaaaggtgccacgattttgagagaatgggaggcatatctgcca
ctcttctggcaactggtaccaccaagtgaagaagactctcctgaagcttgtgccgagttt
gaacgagtacttgccaagcaagcaacaacagtacaatcggcgaagtga

DBGET integrated database retrieval system