KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344290
Entry
4344290           CDS       T01015                                 
Name
(RefSeq) alpha-galactosidase 3
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00561  Glycerolipid metabolism
osa00600  Sphingolipid metabolism
osa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4344290
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4344290
   00600 Sphingolipid metabolism
    4344290
  09107 Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    4344290
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     4344290
SSDB
Motif
Pfam: Melibiase_2 Melibiase_C Melibiase Melibiase_2_C
Other DBs
NCBI-GeneID: 4344290
NCBI-ProteinID: XP_015646774
UniProt: Q69R81 Q7XIV4
LinkDB
Position
7:28764400..28769216
AA seq 425 aa
MEAPRLRLPFLLLVALVVSPPAVAAAASRMRIEPLPTAALRRLYDTSNYGKLQLNNGLAL
TPQMGWNSWNFFACNINETVIRDTADALVSTGLADLGYNYVNIDDCWSNVKRGKKDQLLP
DPKTFPSGIKDLADYVHGKGLKLGIYSDAGIFTCQVRPGSLHHEKDDAAIFASWGVDYLK
YDNCYNLGIKPKDRYPPMRDALNSTGRQIFYSLCEWGQDDPALWAGKVGNSWRTTDDIQD
TWKSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMTFAEYRAHFSIWALMKAPLLIGC
DVRNMTKETMEILSNKEVIQVNQDPLGVQGRRILGQGKNGCQEVWAGPLSGNRLAVVLWN
RCEESANIIVKLPSVGLDGSSPYSVRDLWKHETLSENVVGTFGAQVDVHDCKMYIFTPAV
TVASS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggaggcgccgcgcctccgcctcccgttcctcctactggtggccctcgtcgtctcgccg
ccggcggtcgccgcggcggcgagccgaatgcggatcgagcccctccccaccgccgcgctg
cgccgcctctacgacacctccaactacggcaagctgcagctcaacaacggcctcgccctc
accccgcagatgggatggaacagctggaatttcttcgcctgcaacatcaacgagacggtc
atccgcgacacagctgacgcactagtctcgacggggctggctgatttgggctacaactat
gtaaatatcgatgattgttggtccaatgtaaaaagaggaaaaaaggatcaattgctacct
gacccaaaaactttcccttctggcatcaaagatcttgcggactatgtgcatgggaaaggt
ctaaagcttggtatctactctgatgctgggatttttacatgtcaagttcgacctggatcg
ctccatcatgaaaaggacgatgctgcaatatttgcttcatggggtgttgattacctgaag
tatgacaactgctacaatttgggaataaagcccaaggacaggtatcctccaatgcgtgat
gctttaaattcaactggacgccaaatattctactctctatgtgaatggggccaggatgat
ccagccttatgggctggcaaagttggtaacagttggcgcacaacagatgacatacaggat
acatggaaaagcatgactgatattgctgataagaataacaagtgggcatcatatgctgga
cccggtggatggaatgacccggatatgctggaagtcgggaatggtggcatgacctttgca
gagtatcgtgcacattttagcatctgggcacttatgaaggcccctctcttaattggttgc
gatgtcagaaacatgactaaagaaacaatggaaatattgagcaacaaagaagtaattcaa
gtaaatcaagatcctcttggagttcaaggaagaagaattttaggtcaagggaaaaatgga
tgccaagaggtgtgggctggccccctctctggtaaccgtctggctgttgttttatggaac
cgctgtgaggagtctgccaatattatagtaaaattgccatctgtaggccttgatggttca
tctccctattctgttagagatctgtggaagcatgaaactctatcagagaacgttgttgga
acttttggggcgcaagttgacgtgcatgactgcaaaatgtatattttcactcccgccgtc
accgttgcatcaagttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348984
Entry
4348984           CDS       T01015                                 
Name
(RefSeq) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00561  Glycerolipid metabolism
osa00600  Sphingolipid metabolism
osa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4348984
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4348984
   00600 Sphingolipid metabolism
    4348984
  09107 Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    4348984
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     4348984
SSDB
Motif
Pfam: Melibiase_2 Melibiase_C Melibiase_2_C Melibiase
Other DBs
NCBI-GeneID: 4348984
NCBI-ProteinID: XP_015614153
UniProt: A0A5S6RCE6
LinkDB
Position
10:18707759..18711584
AA seq 413 aa
MAAAAAVLLAVACAAAAMIAGGECGRVVHVGEEHRRSMLANGLATAPPMGWNSWNHFACD
GNGEDVIRETADALVSTGLAAAGYKYVNIDDCWAEPQRDSKGNLVANKKTFPHGIKALAD
YVHSKGLKLGIYSDAGFKTCAKVQPGSLGHEEQDAKTFASWGVDYLKYDNCNNGDLKPLE
RYPEMSKALMMAGRPIYFSLCEWGDMHPAKWGAAYGNSWRTTNDIADTWESMVSRADENE
VWADYARPGGWNDPDMLEVGNGGMTNDEYIVHFSLWAISKAPLIIGCDVRHMSQETYDIL
ANKEVIAVNQDALGIQGKKVRMEGSSEVWAAPLSGYRTAVLLLNRHAAEAAAITAHWDDV
GLPAGTAVEARDLWRHATVAGAGGELTEKITLDVAPHSCRMLLLKPLISSRAN
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggtgctgcttgcggtggcgtgcgccgcggcggcgatgatcgcc
ggcggcgagtgcgggagggtggtgcacgtgggggaggagcaccggaggagcatgctcgcc
aatggcctcgccacggctcctcccatgggctggaacagctggaatcacttcgcctgcgac
ggcaacggagaagacgtcatcagggagactgctgatgcacttgtgtcaaccgggcttgca
gctgctggctacaaatacgtcaacatcgatgattgctgggcagagccacaacgtgattcg
aagggtaatcttgtggccaacaaaaagacattcccccacgggatcaaggcgctcgccgat
tatgttcacagcaaggggctcaagctaggcatttactccgatgcaggattcaagacgtgt
gcgaaggttcagccggggtctctcggccacgaggagcaggacgccaagacattcgcatcg
tggggagtggactacctcaagtatgataactgcaacaatggcgacctgaagccactggag
aggtacccggagatgagcaaggctctgatgatggccggccggccgatctacttctcgctg
tgcgaatggggcgacatgcacccggcgaagtggggcgcggcgtacggcaacagctggaga
accaccaacgacatcgcggacacctgggagagcatggtgtcgagggcggatgagaacgag
gtgtgggcggactacgcgcgacctggcggctggaacgacccggacatgctggaggttggc
aatggcgggatgaccaacgacgagtacatcgtccatttcagcctctgggccatctccaag
gctcctctgatcatcgggtgcgacgtgaggcacatgtcgcaggagacgtacgacatcctg
gccaacaaggaggtcatcgccgtcaaccaagatgctctgggcatccaggggaagaaggtg
aggatggagggcagcagcgaggtgtgggcggcgccgctgtcgggttacaggacggcggtg
ctgctgctgaaccggcacgcggcggaggcggcggcgatcaccgcgcactgggacgacgtc
ggcctccccgccggcaccgccgtcgaggccagggacctgtggcggcacgcgacggtggcc
ggcgccggcggcgagttgacggagaagatcaccctcgacgtggcgccgcactcgtgcagg
atgctcctgctcaagcccctcatctcgtcccgggccaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348988
Entry
4348988           CDS       T01015                                 
Name
(RefSeq) alpha-galactosidase isoform X1
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00561  Glycerolipid metabolism
osa00600  Sphingolipid metabolism
osa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4348988
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4348988
   00600 Sphingolipid metabolism
    4348988
  09107 Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    4348988
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     4348988
SSDB
Motif
Pfam: Melibiase_2 Melibiase_C Melibiase_2_C Melibiase Glyco_hydro_97 Raffinose_syn HemY_N
Other DBs
NCBI-GeneID: 4348988
NCBI-ProteinID: XP_015613565
UniProt: Q9FXT4
Structure
LinkDB
Position
10:18733277..18741365
AA seq 417 aa
MARASSSSSPPSPRLLLLLLVAVAATLLPEAAALGNFTAESRGARWRSRRARRRAFENGL
GRTPQMGWNSWNHFYCGINEQIIRETADALVNTGLAKLGYQYVNIDDCWAEYSRDSQGNF
VPNRQTFPSGIKALADYVHAKGLKLGIYSDAGSQTCSNKMPGSLDHEEQDVKTFASWGVD
YLKYDNCNDAGRSVMERYTRMSNAMKTYGKNIFFSLCEWGKENPATWAGRMGNSWRTTGD
IADNWGSMTSRADENDQWAAYAGPGGWNDPDMLEVGNGGMSEAEYRSHFSIWALAKAPLL
IGCDVRSMSQQTKNILSNSEVIAVNQDSLGVQGKKVQSDNGLEVWAGPLSNNRKAVVLWN
RQSYQATITAHWSNIGLAGSVAVTARDLWAHSSFAAQGQISASVAPHDCKMYVLTPN
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcgcgcgcctcgagctcctcgtctccgccgtcgccgcgcctcctcctcctcctcctg
gtggcggtggcggcgacgctgctccccgaggcggcggcgctgggcaacttcacggcggag
tcccgcggcgcgcggtggcggtctcgccgcgcgcggcgccgcgccttcgagaacggcctc
ggccgcacgccgcagatggggtggaatagctggaaccacttctactgcgggatcaacgag
cagatcatcagggaaacagctgatgcattggtcaacactggtctggcgaaattggggtac
cagtatgtgaatatagatgattgctgggcagaatatagtagggattcccagggtaacttt
gtgccaaataggcagacgttcccctctggtatcaaggcactggcagattatgtgcatgca
aaagggctgaagcttggcatctacagcgatgccgggtcacaaacatgcagtaacaaaatg
ccaggatcacttgatcatgaagagcaagatgtcaagaccttcgcgtcttggggagttgat
tatctgaagtatgacaactgcaatgatgctggcaggagtgtcatggaaagatacactaga
atgagcaatgccatgaagacctatggaaagaatatcttcttctcactctgtgaatggggg
aaagaaaatcctgctacatgggcaggccgcatgggtaacagctggagaacaactggcgac
atcgccgacaactggggcagtatgacatctcgtgcagacgaaaatgaccaatgggctgcc
tatgctggacctggtggatggaatgatcctgacatgcttgaagtgggaaatggtgggatg
tctgaagctgagtaccggtcacacttcagtatctgggcactagcaaaggctcctcttttg
atcggatgcgatgtgcgctcaatgagccagcagacgaagaacatactcagcaactcggag
gtgatcgctgtcaaccaagatagtctaggtgtccaaggaaagaaagtacaatctgacaac
ggattggaggtttgggccgggccactcagcaacaacaggaaggctgtggtgctctggaac
aggcagtcataccaggcaaccatcactgcacattggtcgaacatcgggctcgctggatcg
gtcgcggtcactgctcgtgatctatgggcgcactcttcgttcgcggctcagggacagata
tcagcatcggtggcgcctcatgactgcaagatgtatgtcttgacaccaaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269328
Entry
9269328           CDS       T01015                                 
Name
(RefSeq) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00561  Glycerolipid metabolism
osa00600  Sphingolipid metabolism
osa00603  Glycosphingolipid biosynthesis - globo and isoglobo series
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    9269328
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    9269328
   00600 Sphingolipid metabolism
    9269328
  09107 Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    9269328
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     9269328
SSDB
Motif
Pfam: Melibiase_2 Melibiase_C Melibiase_2_C Melibiase STAT2_C
Other DBs
NCBI-GeneID: 9269328
NCBI-ProteinID: XP_015646191
UniProt: A0A0P0X580
LinkDB
Position
7:15579838..15584502
AA seq 419 aa
MGSYALPRRSLVLFLLSAAAVASTAAWAAASSAAGGGDDAARRSLLDNGLGRTPQMGWNS
WNHFGCNINENTIRSTVDALISTGLTKAGYTYVNLDDCWADYQRTKEGYIAADPKKFPSG
IKALADYVHSKGLKLGIYSSAGSRTCSKTMPGSLGYEDIDAKTFASWGVDYLKYDNCNSD
GSSETVRFPKMSFALRKTGRPIFYSICEWGQRNVATWGGQYGNSWRTTGDINDSWASMLS
NIDSNDASASYAKPGGWNDPDMLEVGNGGMTNDEYVVHISLWAIAKAPLIIGCDVRSISR
ETMEILSNPEVIAINQDPLGVQGKKVRKYDNEIEVWAGPLSQQRTAVLLLNRGATGSRQI
TAAWQDIGVGPGVAVEAKNVWLHATAPGRFTGSLTAEVAAHSCKLFVLTPVGRASEERS
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgggctcctacgctttgccacggcggtctctcgtcctcttcctcctctccgccgccgcc
gtcgcgtcgacggcagcatgggctgccgcttcgtcggcggccggcggtggtgatgatgcc
gctcgccgcagcctcctcgacaacgggctcgggcggacgccgcagatggggtggaacagt
tggaatcatttcgggtgcaacatcaacgagaacaccatccggagcaccgttgacgcactc
atctccaccgggctcacgaaggctggatacacttatgtcaacttagatgattgctgggca
gattaccaaaggaccaaagagggttacatagctgctgatccaaagaagttcccttcgggg
attaaggcactcgcagattatgtgcacagcaaggggcttaaactaggcatatactcttca
gccggctcaagaacttgcagcaaaacgatgcccggatctctgggctacgaggacatcgat
gctaagacatttgcatcatggggtgtggattacttgaagtacgacaactgcaacagtgac
ggctcgagcgaaaccgtcagattccccaagatgtctttcgctctgagaaaaaccggacgt
ccgatcttctactcgatctgcgaatggggccagaggaatgtggcgacgtggggtggccag
tacggcaacagctggaggaccaccggcgacatcaatgactcatgggccagcatgctgagc
aacatcgacagcaacgacgcctccgccagctacgccaagcccggcggctggaacgatcct
gacatgctggaggtcggcaatggagggatgacgaacgacgagtacgtcgtgcacatcagc
ctttgggcgattgccaaggctcctctgatcatcgggtgcgacgtgaggagtatctccagg
gagacgatggagatcctctccaaccctgaagtcatcgccattaaccaagatccattgggc
gtccagggaaagaaagtcaggaagtacgacaacgaaatcgaggtatgggcagggccgctc
tcccagcagaggacggcggtgctgctgctgaaccgcggcgccacgggcagccggcagatc
acggcggcgtggcaggacatcggcgtcggccccggcgtcgccgtcgaggcgaagaacgtc
tggctgcacgcgacggcgccggggaggttcaccggcagcctgacggcggaggtggcggcg
cactcgtgcaagctcttcgtcctcacgcccgtcggccgggccagcgaggagcggagctag

DBGET integrated database retrieval system