KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344352
Entry
4344352           CDS       T01015                                 
Name
(RefSeq) manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
  KO
K01517  manganese-dependent ADP-ribose/CDP-alcohol diphosphatase [EC:3.6.1.13 3.6.1.16 3.6.1.53]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4344352
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4344352
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     4344352
    3.6.1.16  CDP-glycerol diphosphatase
     4344352
    3.6.1.53  Mn2+-dependent ADP-ribose/CDP-alcohol diphosphatase
     4344352
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 4344352
NCBI-ProteinID: XP_015647583
UniProt: Q8H5F8
LinkDB
Position
7:29225285..29227588
AA seq 321 aa
MMAVTNGVIHASSREPLFSFGVIADVQYADIPDGRSFLGVPRYYRHSISVLQRAVSTWNK
QHNIKFSINFGDIIDGYCPKDKSLWAVQKVLDEFEKFDGPTYHMFGNHCLYNLPRGKLVS
LLKMPTDSDRAYYDFSPCPEYRFVVLDAYDFSALGWPRDHPVTAEAMKFLEEKNPNSDKN
SPDGLVGVDRRFVMFNGGVGKEQLSWLNDVLQDASARRQNVILCSHLPMDPGSASFAALM
WNYDEVMAIVRQYKCVKACFAGHDHKGGHSVDSHGVHHRTLEAALECPPGTSAFGHIEVY
PDKLLLVGSDKMADTEMCFEP
NT seq 966 nt   +upstreamnt  +downstreamnt
atgatggctgtgacaaatggagtaatccatgcatcttctagggaacccttattttccttc
ggtgtcattgctgatgtccagtacgctgatattccagatggtcgctcattccttggtgtc
ccacgctactaccgtcatagcatcagcgtcctccaaagggctgtcagcacatggaacaaa
caacacaacatcaagttttcaatcaactttggtgacatcattgatggatattgcccaaag
gacaaatcgttgtgggcagtgcagaaggtccttgatgagtttgagaaatttgatggccca
acttaccacatgtttgggaaccattgcctctataaccttcctcgtggcaagctagtatcg
ttgctgaagatgccaaccgattctgatcgtgcatactatgacttctctccatgtcccgag
tacagatttgttgtcctggacgcttatgacttcagtgcacttggctggccccgtgaccat
ccagtgactgccgaagcaatgaagttcctggaagaaaagaacccaaactctgacaagaac
agccctgacggtctggttggcgttgaccggcggtttgtgatgtttaatggtggagttggt
aaagagcagttgtcatggctcaatgatgtcctccaggatgcatcagcacgccggcaaaat
gtcatcctatgcagtcatctcccaatggatcctggctcagcttcttttgcagctctcatg
tggaactacgatgaggtgatggctattgttcgccagtacaaatgtgttaaggcatgcttt
gccgggcacgaccacaagggaggtcactctgtggactcgcatggcgtacatcaccggact
cttgaggctgcattggagtgtcctcctggtactagtgcattcgggcacatcgaagtgtat
ccagacaagttgttgcttgtgggttctgataaaatggctgatactgagatgtgttttgag
ccctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346295
Entry
4346295           CDS       T01015                                 
Name
(RefSeq) manganese-dependent ADP-ribose/CDP-alcohol diphosphatase-like
  KO
K01517  manganese-dependent ADP-ribose/CDP-alcohol diphosphatase [EC:3.6.1.13 3.6.1.16 3.6.1.53]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4346295
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4346295
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     4346295
    3.6.1.16  CDP-glycerol diphosphatase
     4346295
    3.6.1.53  Mn2+-dependent ADP-ribose/CDP-alcohol diphosphatase
     4346295
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 4346295
NCBI-ProteinID: XP_015648913
UniProt: A0A0P0XJF1
LinkDB
Position
8:complement(27883756..27885281)
AA seq 339 aa
MLVQPPNAVAVRATAAGKEPLFSFGVIADVQYADIPDGRSFLGVPRYYRHSLTILQRAVR
SWNAHNHKHPVAGGGVRFCVNFGDIVDGFCPKDRSLAAVQAVVAEFDRFHGPAYHMLGNH
CLYNLPRSKLVSLLRMPSGRAYYDFSPFPGYRFVVLDAYDFSAVGWPRGHPVAAAARRFL
DERNPNADKNSPSGLAGVDRRFVMFNGAVGEAQLRWLDGVLRGAARRREAAVVCSHLPLH
PGAASPSGLMWNYEEVMRVVHRHGCVAACLAGHDHRGGYGVDARGVHHRTLEAALECPPG
TDAFGRVDVYPDGLTLVGAGRMGSTDMRLQLHSPVTELS
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgctggttcagccgccgaacgccgtggcggtccgggcgacggcggcgggcaaggagccc
ctcttctcgttcggcgtcatcgccgacgtgcagtacgccgacatccccgacggccgctcc
ttcctcggcgtcccccgctactaccgccacagcctcaccatcctgcagagagccgtccgc
tcctggaacgcccacaaccacaagcatcccgtcgccggcggcggcgtccgcttctgtgtc
aacttcggcgacatcgtcgacggcttctgccccaaggacaggtcgctggctgccgtccag
gccgtcgtcgccgagttcgaccgcttccatggcccggcctaccacatgctcggcaaccac
tgcctctacaaccttccccggagcaagctcgtgtcgctgctcaggatgccgtcggggcgc
gcctactacgacttctcgccgttcccgggctacaggttcgtcgtcctcgacgcgtacgac
ttcagcgccgtgggatggccgcgcggccacccggtggcggcggcggcgaggaggttcttg
gacgagaggaacccgaacgcggacaagaacagcccgagcggcctcgccggcgtggaccgg
cggttcgtgatgttcaacggcgccgtcggcgaggcgcagctgcggtggctggacggcgtg
ctgcgcggggcggcgcggcggcgggaggcggcggtggtgtgcagccacctgccgctgcac
cccggcgcggcgtcgccgtcggggctgatgtggaactacgaggaggtgatgcgcgtggtg
caccggcacggctgcgtcgcggcgtgcctcgccggccacgaccacaggggcggctacggc
gtcgacgcccgcggcgtccaccaccgcaccctggaggcggcgctggagtgcccgcccggc
accgacgccttcggccgcgtcgacgtgtaccccgacggcctgacgctcgtcggcgccggc
aggatgggcagcacagacatgcggctccagctccactccccagtgactgagctcagctag

DBGET integrated database retrieval system