KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344462
Entry
4344462           CDS       T01015                                 
Name
(RefSeq) protein mago nashi homolog isoform X2
  KO
K12877  protein mago nashi
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4344462
  09122 Translation
   03013 Nucleocytoplasmic transport
    4344462
   03015 mRNA surveillance pathway
    4344462
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4344462
   03041 Spliceosome [BR:osa03041]
    4344462
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4344462
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4344462
SSDB
Motif
Pfam: Mago_nashi
Other DBs
NCBI-GeneID: 4344462
NCBI-ProteinID: XP_015650605
UniProt: A0A0P0XB70
LinkDB
Position
8:384073..388318
AA seq 158 aa
MATVAGDDGGGGGEFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKKDTMIRKEV
FVSPSVLREATRIIHESEIMKEDDSNWPEPDRVGRQELEIVMGNEHISFTTSKIGSLVDV
QTSKDPEGLRIFYYLVQDLKCFVFSLINLHFKIKPIQS
NT seq 477 nt   +upstreamnt  +downstreamnt
atggcgacggtggccggcgacgatggcggcggcggcggtgagttctacctgcggtactac
gtggggcacaaggggaagttcgggcacgagttcctggagttcgagttccggcccgacggg
aagctccggtacgccaacaactccaactacaagaaggacaccatgatccgcaaggaggtg
ttcgtctccccctccgtcctccgcgaggccaccaggatcatccacgaatccgagattatg
aaggaggatgacagcaactggccggagccagaccgcgtgggaaggcaggagctggagatc
gtgatggggaacgagcacatctccttcaccacctccaagatcggctccctcgtcgacgtc
cagaccagcaaggaccccgagggcctccgcatcttctactacctcgtccaggatcttaag
tgcttcgtgttttcactcatcaatctccacttcaagatcaagcccattcaatcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351998
Entry
4351998           CDS       T01015                                 
Name
(RefSeq) protein mago nashi homolog
  KO
K12877  protein mago nashi
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4351998
  09122 Translation
   03013 Nucleocytoplasmic transport
    4351998
   03015 mRNA surveillance pathway
    4351998
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4351998
   03041 Spliceosome [BR:osa03041]
    4351998
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4351998
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4351998
SSDB
Motif
Pfam: Mago_nashi
Other DBs
NCBI-GeneID: 4351998
NCBI-ProteinID: XP_015618267
UniProt: P49030
LinkDB
Position
12:10959495..10962331
AA seq 160 aa
MATGGAAGEDVPGGGEFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRK
EVFVSPSVLREARRIIQESEIMKEDDNNWPEPDRVGRQELEIVMGNEHISFTTSKIGSLV
DVQTSKDPEGLRIFYYLVQDLKCFVFSLINLHFKIKPIQS
NT seq 483 nt   +upstreamnt  +downstreamnt
atggcgacgggcggcgccgccggcgaggacgtccccggcggcggcgagttctacctgcgg
tactacgtggggcacaaggggaagttcgggcacgagttcctcgagttcgagttccgcccc
gacggcaagctccgctacgccaacaactccaactacaagaacgacaccatgatccgcaag
gaggtcttcgtctccccctccgtcctccgcgaggcccggaggatcatccaggagtccgag
attatgaaggaggacgacaacaactggccagagcccgaccgcgtggggaggcaggagctc
gagattgttatgggcaacgagcacatctccttcaccacctccaagattggctccctcgtc
gacgtccagaccagcaaggaccctgagggcctccgcatcttctactacctcgtccaggat
ctgaaatgtttcgtgttttcactcatcaatctccacttcaagatcaagcctattcaatct
tga

DBGET integrated database retrieval system