KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344474
Entry
4344474           CDS       T01015                                 
Name
(RefSeq) survival of motor neuron-related-splicing factor 30 isoform X1
  KO
K12839  survival of motor neuron-related-splicing factor 30
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4344474
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4344474
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    4344474
 Complex B
    4344474
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   Other proteins involved in snRNP biogenesis
    4344474
SSDB
Motif
Pfam: SMN TUDOR DUF1325 DUF4537 Tudor_3 FlgN
Other DBs
NCBI-GeneID: 4344474
NCBI-ProteinID: XP_015650899
UniProt: Q6ZC63
LinkDB
Position
8:complement(513715..518283)
AA seq 297 aa
MEDLSVEELASNLSTYKEQLREVRKIIKEKNDDPGISEYLDMEKELQEVITLTEELLATA
NQSGNTQNDVGLSPPNYSSGLQSEALDDPSQSHEKFAVGTKVQAVWSEDGEWYNATIEEL
TENGYYVSFEGWGNKEEVDPANVRSLEEEAADALRQAEKEAEATKMAIKRKIEQAATSDF
QMRSLPTKLRIDPNDPEDVKATKRKKIHAFKSKARFEQLEFAQNKRQNAWQQFQTTKGKA
KKVGFFSGRKKESIFKSPDDHRGKVGVTGSGKGLTEFQRREKHLHLKDGSSDALDEE
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaggatctgagcgtggaggagctcgcctccaatctctccacctacaaggagcagctc
cgcgaggttaggaagattatcaaggagaaaaacgatgatcctggaatttctgaatacctt
gatatggaaaaggaacttcaagaggttattacattaacagaagagcttttggcaactgca
aatcaaagtgggaacacccagaatgatgtaggtctatcaccgccaaattattcaagcgga
ctgcagtcagaggcactggatgacccttcgcaatcccatgagaagtttgcagttgggact
aaagtgcaagctgtgtggagtgaagatggggagtggtacaatgcaacaattgaagaactg
acagaaaacggctattatgtaagctttgagggctggggaaacaaagaggaggttgaccct
gctaatgtaagatcgcttgaggaagaagctgctgatgctttgcgtcaagctgaaaaggaa
gctgaagctaccaaaatggcaataaagaggaaaattgaacaggcagcaacatctgacttt
cagatgcgtagcttacccaccaaactccgtatcgatccaaatgatccggaggatgtgaaa
gccacaaagcgtaagaagatccatgcattcaagtcaaaagcccgctttgagcagctagaa
tttgcacaaaataagaggcagaatgcatggcagcagttccaaacgaccaaagggaaagcc
aaaaaggttgggttcttttccggtcgcaaaaaggagagcatcttcaagtcaccggatgat
cacagaggtaaggtcggtgtcactgggagcgggaaaggccttaccgagttccagagaagg
gagaagcacctccatctcaaggatggctcttccgatgcattggacgaggaataa

DBGET integrated database retrieval system