KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344485
Entry
4344485           CDS       T01015                                 
Name
(RefSeq) non-lysosomal glucosylceramidase isoform X1
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4344485
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4344485
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     4344485
SSDB
Motif
Pfam: DUF608 Glyco_hydr_116N Bac_rhamnosid6H
Other DBs
NCBI-GeneID: 4344485
NCBI-ProteinID: XP_015650797
LinkDB
Position
8:complement(580194..586658)
AA seq 941 aa
MGSSELEETKAVLHMDCEKPPAISWERTFDDEGKKVAMFSMTLNDMMAIVPLMIKMLGLN
LKDNAKGLASVYDPLKKWMDNCYRGVPLGGIGAGSIGRSYRGYFQQFQIFPSIYEEKPIL
ANQFSAFISRPDGKRYSTVLSAPNADVLKGIDKAGIGSWDWKLKEKNCTYHGLFPRSWTV
YNGEPDPEIKITCRQISPFIPHNYKESSFPVAVFTFTLHNSGSTPADVTLLFTWANSVGG
KSELTGNHKNSRMTARDGVHGVLLHHRTADGRPPVTFAIASRETDGVRVTGCPRFTMGPS
NSGDVTAKDMWDQINKNGSFVGDGNAAAAATGASRPGSSIGAAVAATTTVAAGGARAVSF
ALSWSCPEVKFPAGRTYHRRYTKFHGTDRDAAAERLAHDALLEHMKWESQIEEWQRPILQ
DKSLPEWYPITLFNELYYLNAGGTIWTDGQPPKNTSLSSATEPFNLDTFSTVANGGSAVD
GILSTVAVAAARSNTAAAAAAAMGTALLRDGEENVGQVLYLEGMEYNMWNTYDVHFYASF
ALLSLFPELELNLQRDFVRGVLLHDPCLRRTLDGATVARKVLGAVPHDMGLNDPWFEVNA
YMLHDPVRWKDLNPKFVLQVYRDVVATGNAGFAEAAWPAVYLAMAYMDQFDRDGDGMVEN
EGRPDQTYDLWSVSGVSAYTGGLWVAALQAAAAMAGIVGDGAAEAYFRGRYHRARRVYTD
ELWNGGYFNYDNSGGATSSSIQADQLAGQWYARACGLEPIVDGDKARRALATVLDYNVMR
VKGGAIGAVNGMRPDGAVDASSTQSKEVWPGVTYAVAAAMIHEGMPEAAFKTAKGIHDAG
WGKHGFGYAFQTPESWTADGGYRALHYMRPLGVWAMQWALSPPVLHKEHRVAAVAASPED
AALGQEKFDKVASMLRLPEEQQHKGILRALYDTLRQLLLPS
NT seq 2826 nt   +upstreamnt  +downstreamnt
atgggaagttcagaattggaggaaaccaaggcagtcctgcacatggattgtgaaaagcca
ccagcaatatcttgggagaggacatttgatgatgaaggaaagaaggttgcaatgtttagc
atgaccttgaatgacatgatggcaattgtgccgttgatgattaaaatgctgggactaaac
ctgaaagacaatgcaaaaggcctggcttcagtgtatgatccactgaagaaatggatggac
aactgctaccgcggtgtacccctcggtgggattggtgcagggagcatagggagaagctac
aggggatattttcagcagtttcagatattccccagtatatatgaagagaagcctatccta
gcaaatcaattttcagcattcatttcgcgccctgacggaaagagatactcgacagtgttg
tcggcaccgaatgccgatgtcctcaagggaatcgataaagctggcattggatcctgggac
tggaagctgaaagagaagaattgcacttaccatggcttgttcccaagatcatggacagta
tacaatggtgaacctgaccctgaaattaaaataacttgccgtcagatatcaccgttcatt
cctcacaactacaaggagagcagcttccctgttgcagttttcacttttacgttacacaat
tctggaagcacacctgcagatgtaacactgctcttcacatgggcaaattcggttggaggg
aaatctgaactgaccgggaatcataagaactccagaatgacagctcgcgacggcgtccat
ggcgtcctcctccatcacaggacggcggatgggcgccctccggtgacgttcgcgatcgcg
tcgcgggagaccgacggcgtccgcgtcaccggctgcccgcgcttcacgatgggaccatcc
aactccggcgatgtcacggcgaaggacatgtgggatcagatcaacaagaatggttcgttc
gtcggggacggcaatgcggcggcggcggcgacgggagcgtcgaggcccgggtcgtccatc
ggagcggcggtggcggcgacgacgacggtggcggcgggtggcgcgcgcgcggtgtcgttc
gcgctgtcgtggtcgtgccccgaggtgaagttcccggcggggagaacctaccacaggagg
tacaccaagttccatggcaccgatcgcgacgcggctgctgagcgcctggcccacgatgct
cttcttgaacacatgaaatgggagtcccagatcgaggagtggcagaggcctattctgcag
gacaagagcctacctgaatggtatccaattacactgttcaacgagctctactacctcaac
gctggaggcaccatttggacagatgggcagcctccgaagaacaccagcctttcgtcagcg
actgagccgttcaacctcgacacgttcagtacagtcgccaacggcggcagcgcggtcgac
ggcattttgagcacggtggcggtggcggcggcgcggtcgaacacggcggcggcggcggcg
gcggcgatgggcacggcgctgctgcgcgacggcgaggagaacgtggggcaggtgctgtac
ctggaggggatggagtacaacatgtggaacacctacgacgtccacttctacgcctccttc
gccctcctctccctcttccccgagctcgagctcaacctccagcgcgacttcgtccgcggc
gtcctcctccacgacccctgcctccgccgcacccttgacggcgccaccgtggcgcgcaag
gtgttgggagcggtgccacatgacatggggctgaacgacccgtggttcgaggtgaacgcg
tacatgctgcacgacccggtgaggtggaaggacctcaacccaaagttcgtgctgcaggtg
taccgcgacgtggtggcgacggggaacgccggcttcgcggaggcggcgtggccggcggtg
tacctggccatggcgtacatggaccagttcgaccgcgacggcgacgggatggtcgagaac
gagggccgccccgaccagacctacgacctgtggtcggtgtccggcgtcagcgcctacacc
ggcggcctctgggtggcggcgctccaggccgccgcggccatggcgggcatcgtcggcgac
ggcgccgccgaggcctacttccgggggaggtaccaccgcgccaggcgcgtgtacacagac
gagctctggaacggcggctacttcaactacgacaacagcggcggcgccaccagctcgtcg
atccaggccgaccagctcgccggtcagtggtacgcgcgggcgtgcgggctggagccgatc
gtggacggcgacaaggcgcggcgagcgctggcgacggtgctcgactacaacgtcatgcgg
gtgaagggcggcgccatcggcgccgtcaacgggatgcggccggacggcgccgtggacgcg
tcgtcgacgcagtccaaggaggtgtggcccggggtgacgtacgccgtcgccgccgcgatg
atccacgaggggatgccggaggcggcgttcaagacggccaagggcatccacgacgccggc
tggggcaagcacggcttcggctacgcgttccagacgccggagtcgtggacggccgacggc
ggctaccgggcgctgcactacatgcgcccgctcggcgtctgggcgatgcagtgggcgctg
tcgccgccggtgctccacaaggagcacagggtggcggcggtggcggcctcgccggaggac
gccgcactggggcaggagaagttcgacaaggtagcgagcatgctgaggctgcctgaggag
cagcagcacaaggggatccttcgggcgctctatgatactcttcgccaattgctgctccca
tcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348876
Entry
4348876           CDS       T01015                                 
Name
(RefSeq) non-lysosomal glucosylceramidase
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4348876
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4348876
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     4348876
SSDB
Motif
Pfam: DUF608 Glyco_hydr_116N Bac_rhamnosid6H
Other DBs
NCBI-GeneID: 4348876
NCBI-ProteinID: XP_015614460
UniProt: Q7XDG7 Q0IX18
LinkDB
Position
10:complement(17584548..17592697)
AA seq 974 aa
MVSGNLFHCRRNSWPAEEYVGRTALQLLDFDGGSPPEQAWRRRLNSHANLLKEFSVTFME
AMRMMSLGLRLWSYVREEASHGRKAPIDPFTKEKCKPSASQGVPLGGMGSGSISRGFRGE
FKNWHIIPGLCETSPVMENQFSIFVSRDGGNKKYSSVLSPGHHEGLKKCNDSGISSWDWN
LSGQHSTYHALFPRAWTVYDGEPDPDLKISCRQISPFIPHDYKDSSLPTSVFVYTLVNTG
KDRAKVSLLMTWANSIGGFSHHSGGHFNEPFIAEDGVSGVLLHHKTAKDNPPVTFAIAAC
ETQNVNVTVLPVFGLSGEGHDSAKQMWDRMKQNGHFDRENFEAGTSMPSSSGETLCAAVS
ASTWVEPHGRCTVVFGLAWSSPKIKFQKGCTYNRRYTEFYGTSERSAVNLVHDALTKYRI
WEEEIEKWQNPILKNEKLPEWYKFTLFNELYFLVAGGTVWTDGQPPVIDEKPSPGSNQQK
SSKRGTRDTKQESVKDNHVKLTAEQVTNGGDLANGEEQSVSKYAAVHGPQMAKATNGLGS
QEPIPYLLSKNGPENVGKFLYLEGVEYIMWCTYDVHFYASFALLDLFPKIELSIQRDFAN
AVLYEDRRRMKFLADGTSGIRKVKGAVPHDLGTHDPWHEMNAYNIHDTSKWKDLNPKFVL
QVYRDFAATGDMSFGRDVWPAVCAVMDYMNQFDRDGDGLIENDGFPDQTYDAWTVHGISA
YCGGLWLAALQAAATMAHRLGDRPFAEKYKLKFIQAKAVYEAKLWNGSYFNYDSGTSSNS
RSIQADQLAGQWYAASSGLPPLFDENKIRSALQKIFEFNVMKVKGGRLGAVNGMTPNGKV
DETCMQSREIWTGVTYGVAANMLLHGMEHQGFTTAEGIFIAGWSEEGYGYWFQTPEGWTI
DGHYRSLIYMRPLAIWAMQWARSPPKAILDAPKVNLMDRIHLSPQMIRAMNEINVRKIAP
DNRCFPSSAFRCEC
NT seq 2925 nt   +upstreamnt  +downstreamnt
atggtgagcggcaacctcttccactgccggaggaactcgtggccggccgaggagtacgtc
ggccgaaccgccctgcagttgttggacttcgacggcgggtcgcctccggagcaggcatgg
cggcggcgtctgaacagccacgccaacttactcaaggaattcagcgtcaccttcatggaa
gcaatgaggatgatgagccttggcctgaggctatggtcgtatgtccgagaggaggcttct
catggaaggaaagctccaattgatccgtttaccaaagagaaatgtaagccgtctgcttcg
cagggcgtaccgcttggtgggatggggagtggtagcatttcaagaggtttcaggggagag
ttcaagaattggcatatcattcctggtttatgtgagacttccccggtcatggagaaccag
ttttcaatatttgtatctcgcgatggggggaacaaaaagtactcatcggtattgtctccc
ggacaccatgaaggtttaaagaaatgtaatgactctggaatttcttcatgggactggaac
ttgagcggtcaacattctacctatcatgctttatttcctagggcatggactgtttatgat
ggtgaaccggatccagaccttaaaatctcatgtcgtcagatatcaccattcattcctcat
gattacaaagatagcagcctcccaacttctgtctttgtgtacactctagtgaacactggg
aaagaccgtgcgaaagtgagcctgttaatgacatgggcgaattctatcggaggtttttct
catcactctggaggccattttaatgagcccttcattgcggaggatggagtttcaggagtt
cttctgcatcacaaaacagcaaaggataatcctccggttacttttgctattgctgcctgt
gaaactcagaatgtgaatgtgacagtcttgcctgtatttggcctctctggagaaggccat
gattcagccaagcaaatgtgggatagaatgaaacagaacggccactttgaccgtgaaaat
ttcgaagctggtaccagtatgccttcatcttcaggggagacactttgtgcagctgtctca
gcatcaacctgggtagagccacatggtagatgtactgttgtatttggtttggcttggtcc
tctcctaaaataaagtttcagaagggctgcacatacaacaggaggtacactgaattttat
ggaacttctgaaagatcagctgttaatttggtacacgatgccttgacaaaatataggatt
tgggaagaggagattgagaagtggcaaaaccccatactcaagaatgaaaaacttccagaa
tggtacaagttcacactttttaatgagctttactttctggtagctgggggtactgtttgg
acagatggccaaccaccagttatcgatgaaaaaccaagtcctggttctaatcaacagaaa
tcttcaaaaaggggcactagagacactaaacaggaatcagttaaagataaccatgtcaaa
ctgacagcagagcaagtcactaatggtggtgacctggctaatggcgaagagcaaagtgtg
tcaaagtatgcagcagtacatggaccacaaatggctaaggcaaccaacggacttgggtca
caagagccaattccatacttgctttccaagaatggccctgaaaatgttggcaaatttttg
tacctggaaggagtggaatacatcatgtggtgcacctatgatgtgcatttctatgcttct
tttgctctgcttgatctgtttcccaaaatagagttgagtatccaacgtgattttgccaat
gctgttctctatgaagacagacgaagaatgaaatttttggctgatggtacttctggaatt
cgcaaggtcaaaggtgccgttccgcatgacctaggaacacatgatccatggcatgaaatg
aatgcgtacaacatacatgatacaagcaaatggaaagatctaaatccaaagtttgtgctc
caggtatacagagacttcgctgctacaggtgatatgtcatttggtagagatgtttggcct
gccgtctgtgcagtgatggactatatgaatcaatttgaccgtgacggtgatggtctcatt
gagaatgatgggtttcctgatcaaacctatgatgcttggactgtacacggaattagtgct
tactgtggcggtctctggcttgctgcacttcaggctgcagctacaatggctcatcggctt
ggtgatcggccatttgctgaaaaatacaagctcaaattcatacaagcgaaagcagtatat
gaggctaagttatggaatgggtcttacttcaattatgacagtggcacaagcagtaatagc
cgatctattcaggcggatcagctggcagggcagtggtatgctgcttcttcaggcttgccc
ccgcttttcgatgagaataaaataagaagtgctctgcagaaaatatttgaattcaatgta
atgaaggttaaaggaggacgattgggagctgtaaatggtatgactcctaatgggaaagtg
gatgagacatgcatgcaatctcgggaaatctggaccggtgttacatacggtgttgctgca
aacatgctgctccatggaatggagcatcaaggattcaccactgccgaaggaatttttatt
gctggttggtcagaagaaggatatgggtattggttccaaacaccggaaggctggaccata
gacgggcactacaggtcgctcatctacatgcggcctctcgccatttgggcaatgcaatgg
gcacgttctccacccaaggcaatccttgatgcccccaaggtaaacctgatggacaggata
cacctatccccacaaatgatccgggcaatgaacgagattaatgttagaaagatagcaccc
gacaatagatgtttccctagctctgcatttcgttgtgaatgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350171
Entry
4350171           CDS       T01015                                 
Name
(RefSeq) non-lysosomal glucosylceramidase isoform X1
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4350171
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4350171
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     4350171
SSDB
Motif
Pfam: DUF608 Glyco_hydr_116N DUF5127 EF-hand_1 EF-hand_5
Other DBs
NCBI-GeneID: 4350171
NCBI-ProteinID: XP_015617334
UniProt: B9GA45 Q2R859
LinkDB
Position
11:7595279..7606850
AA seq 950 aa
MVENGVLEQPKGVSRNRPRAQSNDHPVDPGYLPELTWEHKLSNIGYDLPSFRLTWRETFQ
LAGLGLRLGRHILEETSKGRAAVIDPMKKRIAKSGQGVPLGGIGSGSIGRSYKGEFQRWQ
LFPGTCEERPVLANQFSAFISRKDGRNYSSVLHPGKPDLPKGSNISGIGSWDWNMSGQNS
TYHALYPRSWTIYNGEPDPDVNIVCRQISPIIPHNYQQSSYPVSVFTFTVTNSGNTAADV
TLLFTWANSVGGKSELTGYHSNSPMIEKDGVHGILLHHRTANGQPPVTFAIAAQEKEDIH
ISECPYFIISGSSDAFSAKDMWNYVKENGSFDNLDLTKTSMCSKPGLSIGAAIAASVKLP
PQTTQNVSFALAWACPEVKFSSGKTYHRRYTKFHGTDNDAAASLAHDAILEHNSWERQIE
EWQNPILQDERFPDWYPVTLFNELYYLNAGGTIWTDGLPPIQSLTGIGEKKFSLDMQNGD
ADDANGIIPRNNTASDILNQMASVLERIHASMESNSAIGTTLLQGEENIGQFLYLEGIEY
YMWNTYDVHFYASFSLIMLFPKLQLSIQRDFAAAVLMHDPEKLRMLHDGKWVARKVLGAV
PHDLGLYDPWFKVNAYTLYNTDRWKDLNPKFVLQVYRDVVATGDKSFARAVWPSVYMAMA
YMEQFDRDKDGMIENEDFPDQTYDVWSMAGISAYCGGLWVAALQAASALAHEVGDKASEK
LFWDKYEKAKSVYGKLWNGSYFNYDDGDNIMSASIHADQLAGQWYAKACGLFPIVDKDKA
ESALEKIYSFNVMKFKDGKRGAMNGMWPDGTVDMSAMQSREIWPGVTYALAATMIQEGMV
EKGFKTAEGIYHAAWSPEGLGYSFQTPEAWNNDDEYRSLCYMRPLAIWAIQWALSNPKLH
KQTADIPQDSFPKNQFSYARIAKLLHLPEDESPKSFLRVIYEIVRNRYRS
NT seq 2853 nt   +upstreamnt  +downstreamnt
atggtagagaatggtgttctggagcaaccaaagggggtgtctcgaaataggccacgtgct
cagtcgaatgatcatccagttgatcctggatacctcccagagttgacatgggaacacaag
cttagcaatattggctatgatttgccatccttcagacttacatggagagagacattccag
ttggctggccttggtcttcgtcttggccgacacatccttgaagaaacatcaaaaggacgt
gctgctgtgattgatcccatgaagaagcgcattgcaaaatctggtcagggtgttccactt
ggcggcattggttcaggaagtattggaaggagctacaaaggcgagtttcaacgctggcaa
ttgttcccgggaacttgtgaagagagacctgtactggcaaatcaattttctgcgttcatt
tcccgcaaagatggtagaaactattcctcagtgctgcatcctgggaaaccagatttgcca
aaaggaagtaacatttcaggaattggatcctgggactggaatatgagtggacaaaactct
acgtaccacgctctttaccctaggtcctggacgatatacaatggagaacctgacccagat
gtcaacatagtgtgtcgtcagatttctccaattattccacataattatcaacagagcagc
tatccagtttctgtattcactttcacagtaactaactcaggcaatacggctgctgatgta
actttgctttttacatgggctaactctgttggtgggaaatctgaactaactggatatcac
tccaattcccctatgatagaaaaggatggtgtgcatggcattctgttacatcacagaaca
gctaatggacaaccaccagttacttttgccatagctgcacaagagaaagaagatattcat
atctcggaatgcccttactttataatatctggaagttctgatgcattttcagcaaaagac
atgtggaattatgtgaaagagaatggatcttttgataaccttgatctcaccaaaacatcg
atgtgctcaaaacctggattatcaataggggcagctattgcagcttctgttaagctgcct
ccccagacaacccagaatgtatcatttgcacttgcctgggcttgtcctgaagtgaaattc
tccagtggaaaaacctaccataggcgttatacgaaatttcatggcacggataatgatgca
gcagcaagccttgctcatgatgccattctagaacataattcttgggaaaggcaaattgag
gagtggcagaatcctattttgcaagatgagaggtttcctgactggtacccggtcacactt
ttcaatgagttatactaccttaatgctggaggaactatatggactgatggattgccacca
attcaaagcttgacaggtattggtgaaaagaagttttctctggacatgcaaaatggggac
gctgatgatgccaatgggataatcccacggaataatactgccagcgacatccttaatcaa
atggcatcagtactcgagagaattcatgcatctatggaatcaaattctgccataggaaca
actttacttcagggtgaagagaatattggccaattcctctaccttgagggcattgagtat
tatatgtggaacacatatgatgttcatttctatgcatcattctctctgatcatgctgttt
ccaaaactccagctcagcattcagagagatttcgctgctgctgttttgatgcatgatcct
gaaaagctcaggatgttacatgatggaaaatgggttgcgagaaaagttcttggtgctgtt
cctcatgatcttgggctatatgacccctggttcaaagttaatgcatatacgctctataac
acagatcgatggaaggacttgaacccaaagtttgttctgcaagtttatagagatgtggtt
gccacaggtgacaaatcctttgctcgtgctgtttggccatctgtttatatggcaatggca
tatatggagcaatttgacagggataaagatgggatgattgaaaatgaggactttccagat
cagacttatgatgtgtggtcaatggctggtataagtgcgtactgtggtggactttgggtg
gccgctcttcaagctgcgtcagccttggcacacgaagttggtgacaaagcgtctgaaaaa
cttttctgggacaagtatgagaaggctaagtctgtttatggcaagttgtggaatggttct
tacttcaattatgatgatggcgacaacataatgagtgcatccatccatgcggatcaattg
gctggacaatggtatgccaaagcttgcggtctcttcccaattgttgacaaggataaggcg
gaaagtgcactagaaaagatatattctttcaatgtgatgaaattcaaggatggtaaaagg
ggagcaatgaatgggatgtggccagatggcacagtggacatgtccgcaatgcaatctcgg
gagatatggccaggtgtgacatatgcacttgctgcaaccatgattcaagaaggcatggtt
gagaaggggttcaaaacagctgaggggatttatcatgctgcctggtctccagaaggactt
gggtactcatttcaaacccctgaagcttggaacaatgacgatgaataccgatcgttgtgc
tacatgcgccctcttgcaatatgggccatacagtgggcactatcaaacccaaaactccac
aagcagactgcagatatcccacaggactctttcccaaagaaccagttctcgtatgctcgg
attgcgaagttgctgcatttacctgaagacgaatcgccgaagagtttccttcgagtgatt
tatgagattgttcgtaacaggtataggtcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268048
Entry
9268048           CDS       T01015                                 
Name
(RefSeq) non-lysosomal glucosylceramidase isoform X1
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    9268048
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    9268048
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     9268048
SSDB
Motif
Pfam: DUF608 Glyco_hydr_116N Bac_rhamnosid6H
Other DBs
NCBI-GeneID: 9268048
NCBI-ProteinID: XP_015647089
LinkDB
Position
7:complement(15069451..15078054)
AA seq 947 aa
MVSSNMFYRRKRSWRAGDLVSRSTLQLLDFDDGSPPEYAWRRKLSSHANRLKEFNVTFRE
AIKMMKLGLRLWSYIREEASHGRKAPIDPFTRESDKPSASQGVPLGGMGSGSISRGFRGE
FKHWQIIPGSCEMSPVMANQFSIFITRGGNKKYSSVLAPGQHDSLKKSNDDGISSWDWKL
RGDRSTYHALFPRAWTVYDGEPDPELKVSCRQISPFIPHNYQESSLPTSVFVYTIVNTGK
ERAKVSLVMTWANSIGGLSHHSGGHVNEPFIGENGVSGVLLHHKTANNNPPVTFAVAACE
NQNVNVTVLPAFGLSGESSVTAREMWGTLSQDGCFDRDNFSAGPSMPSSLGDTVCAAVCA
STWVEPHGRCTVVFSLAWSSPKVKFKKGNAYYRRYTKFYGTSPRSAINLVQDSLMKYKHW
EEEIDKWQRPILHDERFPEWCVLVHDLPVGCCKAVLSLWYKVTLFNELYFLVAGGTVWID
SASLMADADEMMNSRLSEDNDLPLHHSSRNSAVPLIGFSPHIIDDRENVGKFLYLEGIEY
FMWCTYDVHFYASFALLELFPKIELSIQRDFATAVLREDKSRVRFLADGTWGTRKVIGAV
AHDLGAHDPWHELNAYNIHDTSRWKDLNPKFVLQVYRDFAATGDMSFGKDVWPAVCTAME
YMEQFDHDDDGMIENDGFPDQTYDAWTVRGVSAYCGCLWLAALQTAAALARTLGHHDYAE
RCMLKFAKAKPVFEAKLWNGSYFNYDSGTSYNSRSIHADQLAGQWYTASSGLPPLFDEGR
IKCTLQKIFDYNVMRVKGGRMGAVNGMHPNGKVDETCMQSREIWTGVTYSLAATMLLHGM
DDQAFTTAEGIFTAGWSEEGYGYWFQTPEAWTIDGHYRSLIYMRPLAIWAMQYALSPPRT
ILEAPKVNTMDRTSYISPSTLQFLQDSVRKMTPKNSCFGSSSSNCEC
NT seq 2844 nt   +upstreamnt  +downstreamnt
atggtgagcagcaacatgttctaccggaggaagcgctcatggcgtgccggtgatctcgtg
agcaggagcaccctgcaattgctggactttgatgatggctcaccaccagaatatgcttgg
agaagaaaactaagtagtcatgccaatagattgaaggagttcaatgttacctttagagaa
gcaattaagatgatgaaacttggtctgcgcctctggtcatatattcgggaagaagcttct
catggaaggaaagcaccaattgatccattcacgagggagagcgacaaaccttcagcctcg
caaggtgtacctcttggtgggatggggagcggtagcatttcaagagggttcagaggagaa
tttaaacattggcagataatcccaggttcatgtgaaatgtcaccagtcatggcaaaccaa
ttttcgatctttataactcgaggaggaaacaaaaaatactcctctgttttagctcctggt
cagcatgatagtttaaagaaatctaatgatgatggtatatcatcctgggattggaaacta
agaggtgatcgttctacataccatgcgttgtttcctcgagcatggactgtctatgatggt
gaacctgatcctgaattgaaagtatcttgccggcaaatatctccttttattccccataac
tatcaagagagcagtcttcctacctctgtttttgtttacactatagtgaacactggtaaa
gaaagggcaaaagtcagcctcgtaatgacctgggcgaattctattggagggctttcccat
cattccggcggtcatgtaaatgagccatttataggagaaaatggagtttctggcgtgctt
ctgcatcacaagactgccaacaataatcctcctgtaacttttgctgttgcagcatgtgag
aaccaaaatgtaaatgtcactgtgttgcctgcttttgggctttctggagaaagttctgtt
acagctagggaaatgtggggcacattgagccaggatggttgcttcgaccgagataatttc
agtgccggccctagcatgccttcttcgctgggtgatacagtttgtgcagcagtttgtgca
tccacctgggttgaaccacatggaagatgtacagtcgtattttccctggcttggtcatcc
cctaaggtcaaatttaagaagggaaatgcatactacaggaggtatacaaaattttatgga
acttctccaaggtcagctataaacttggtgcaagattctttgatgaagtataagcactgg
gaagaggaaattgataagtggcagaggccaattctccatgatgagaggtttccggagtgg
tgtgtacttgtacatgacttaccagttggctgctgcaaggcagtattatccttgtggtac
aaggttactctcttcaatgagctgtacttcctagttgctggaggaactgtttggatagat
agtgcatctttgatggctgatgctgatgaaatgatgaactcaaggctatctgaggacaat
gatttgccacttcatcatagcagtcgcaattctgcagttccactcattggttttagccca
catataattgatgacagggaaaatgtagggaagtttttatacctggaaggaatagagtac
ttcatgtggtgcacttatgatgtacacttctatgcctcttttgctcttctggaactgttt
cctaagattgagctgagcattcaacgtgattttgctacagctgttctgcgcgaagataaa
agtagagtcaggtttcttgctgatggtacttggggcactcgcaaagtaatcggtgctgtt
gcccatgaccttggggcccatgatccttggcatgaattgaatgcgtacaacatacatgac
acaagtagatggaaagatctcaatcccaagttcgtgctacaggtttacagagatttcgcg
gcaacaggtgacatgtcatttggcaaggatgtctggcctgcggtttgtactgctatggag
tacatggaacagtttgaccatgacgatgatggtatgattgagaatgatggctttcctgat
caaacatatgatgcttggacagttcgtggagtaagtgcctactgtggttgcctttggctt
gctgcccttcaaactgcagcagcgctggcccgcacccttggacaccatgattatgctgag
aggtgcatgttgaagtttgcaaaagctaagcccgtatttgaagcaaagttatggaatggt
tcatattttaattatgacagcggaacaagttacaacagtcgctccatccatgcggatcaa
ctggctggacaatggtatactgcatcgtcaggtttgccgcctctgtttgatgagggtagg
ataaaatgcacccttcagaaaatatttgactataatgtgatgagggtaaaaggagggcgt
atgggagctgtgaacggtatgcatccaaatggtaaggtagacgagacttgtatgcagtca
agagaaatctggacaggagtaacgtacagtttagctgctactatgctgctccatggaatg
gacgatcaggctttcactactgcagaaggcattttcaccgcaggatggtccgaagaaggc
tatgggtactggttccaaacccctgaagcatggacgatcgacggccactacaggtcgctg
atatacatgcggccccttgcaatctgggcaatgcagtatgcattgtctcctccaagaacc
atactcgaggcgccgaaggtgaacaccatggacaggacctcctacatctcgcccagcacg
ctccagttcctgcaggacagcgtcaggaagatgacgcccaagaacagctgcttcgggagc
agctcgtctaactgcgaatgctga

DBGET integrated database retrieval system