KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344519
Entry
4344519           CDS       T01015                                 
Name
(RefSeq) exosome complex component RRP41-like
  KO
K12587  exosome complex component MTR3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4344519
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4344519
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     4344519
SSDB
Motif
Pfam: RNase_PH RNase_PH_C
Other DBs
NCBI-GeneID: 4344519
NCBI-ProteinID: XP_015649032
UniProt: A3BP26 Q69UI6
LinkDB
Position
8:complement(935967..940503)
AA seq 262 aa
MSAAAAATDGTYSPAAAAGEKRRERKEELRRHLAEDADWPRADGRSFHDCRPAFMQTGPT
TAASGSAYAEFGKTKVIVSVFGPRESKKAMLYSDTGRLNCNVSYTTFATPIRGQGMDNKE
YSAMLHKALEGAVMLHTFPKTTVDVFALVLESGGSDLPIIISCASLALADAGIMIYDLVT
SVSVSCFGKNIIIDPTSDEEAWQDGSIMVAYMPARKEITQLTLTGEWSDGKITNAVELCM
DACSKLCDILRERLKDAASLAE
NT seq 789 nt   +upstreamnt  +downstreamnt
atgtcggcggcggcggcggctactgatgggacgtactctccggcggcggccgcgggggaa
aagcggagggagaggaaggaggagctgcggcgccacctcgccgaggacgccgactggccc
cgcgccgacggccgctccttccacgactgccgtcccgcatttatgcaaacaggaccaaca
actgccgcatcaggatctgcttatgcagaatttgggaagacaaaggtcattgtgtcagtg
tttggaccaagagaaagcaagaaagcaatgttgtacagtgataccggtagactcaattgc
aatgtgagctacacaacatttgccacccctatacgtggacagggaatggacaacaaggag
tactccgcaatgctccataaagccctggaaggcgcagtgatgctacacacttttccaaaa
accactgttgatgtctttgcgttggttcttgagtctggtggcagtgatcttcccatcatt
atttcttgtgctagtcttgcgttggctgatgccggaatcatgatatatgaccttgttaca
tcggtatctgtgtcctgtttcgggaagaacattatcatcgatccaacctctgacgaggaa
gcatggcaagacggcagcattatggtggcgtacatgccagcccgcaaggagatcactcag
ctaacacttactggagagtggtctgatggcaaaatcaccaatgcggtagagctctgcatg
gatgcttgtagtaagctctgtgacatactacgggagcgcttgaaagatgctgccagcttg
gctgagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269241
Entry
9269241           CDS       T01015                                 
Name
(RefSeq) exosome complex component RRP41-like isoform X1
  KO
K12587  exosome complex component MTR3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    9269241
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    9269241
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     9269241
SSDB
Motif
Pfam: RNase_PH RNase_PH_C
Other DBs
NCBI-GeneID: 9269241
NCBI-ProteinID: XP_015628499
LinkDB
Position
3:35494051..35497796
AA seq 266 aa
MSAAATAGTYSPASAAGEKRRERKEELRRHLAEDADWPRADGRSFHDCRPAFMQTGPTTA
ASGSAYAEFGKTKVIVSVFGPRESKKAMLYSDTGRLNCNVSYTTFATPIRGQFASLFQGT
DNKEYSAMLHKALEGAVMLHTFPKTTVDVFALVLESGGSDLPIIISCASLALADAGIMMY
DLVTSVSVSCFGKNIIIDPTSDEEAWQDGSLMVAYMPARKEITQLTLTGEWSDGKITNAV
ELCMDACSKLCDILRERLKDASSLAE
NT seq 801 nt   +upstreamnt  +downstreamnt
atgtcggcggctgccaccgctgggacctactctccggcttctgccgcgggggaaaagcgt
cgggagaggaaggaggagctgcggcgccacctcgccgaggacgccgactggccccgcgcc
gacggccgctccttccacgactgccgtcctgcatttatgcaaacaggaccaacaaccgct
gcatcaggatctgcttatgcagaatttgggaagacaaaggtcattgtgtcagtgtttgga
ccgagagaaagcaagaaagcaatgttgtacagtgatactggtagactcaattgcaatgtg
agctacacaacatttgccactcctatacgtgggcagtttgcatctttgttccagggaaca
gataacaaggagtactccgcaatgcttcataaagctctggaaggcgcagtgatgttgcac
acttttccaaagaccactgttgatgtttttgccttggttcttgagtctggtggcagtgat
cttcccatcattatttcttgtgctagtcttgcgttggctgatgctggaatcatgatgtat
gaccttgttacatcagtatctgtgtcctgttttgggaagaacataatcattgatccaacc
tctgacgaggaagcatggcaagacggcagccttatggtggcgtacatgccagcccgcaaa
gagatcacgcagctaactcttactggagagtggtctgatggcaaaatcacgaacgcggtg
gagctctgcatggatgcctgcagtaagctctgtgacatacttcgggagcgcttgaaagat
gcttccagcttggctgagtga

DBGET integrated database retrieval system