KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344572
Entry
4344572           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-splicing factor SLU7
  KO
K12819  pre-mRNA-processing factor SLU7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4344572
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4344572
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Step II factors
    4344572
SSDB
Motif
Pfam: Slu7 zf-CCHC_4
Other DBs
NCBI-GeneID: 4344572
NCBI-ProteinID: XP_015650437
UniProt: Q6ZK48
LinkDB
Position
8:1585139..1589003
AA seq 536 aa
MATASVSFKSREDHRKQLELEEARKAGLAPAEVDEDGKEINPHIPQYMSSAPWYLNADKP
SLKHQRNWKSDPNYTKSWYDRGAKLFQANKYRKGACENCGAMTHDKKSCMERPRSVGAKW
TNINIAPDEKVESFELDYDGKRDRWNGYDPSTYTRVIADYEAREEARKKYLKEQQLKKLE
EKDGEEGDENVASEEEDEEDGLKIDEAKVDESAQMDFAKVEKRVRTTGGGSTGTVRNLRI
REDTAKYLLNLDVNSAYYDPKTRSMREDPLPDADPNDKFYVGDNQNRLSGQALEFKQLNI
HAWEAFDKGQDIHMQAAPSQAELLFKSFKIKKEKLKSENKDKIMEKYGNAASEEPIPREL
LLGQSEKEIEYDRTGRIIKGQDVALPKSKYEEDVFINNHTTVWGSWWKDHQWGYKCCKQT
IRNSYCTGLAGIEAAEASADLMKANMARKEAAEDEPVRHEEKRLATWGTDVPNDIVLDKK
LLDEALKKEGARRKEEMDERKRKYNVKWNDEVTAEDMEAYRMKRIHHDDPMRDFLH
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggcgaccgcttcggtgtcgtttaagtctagagaggatcaccggaagcagctcgagctc
gaggaggcgaggaaggctgggctcgcgcccgccgaggtcgacgaggatggaaaggagatc
aatccccatatcccccagtacatgtcctcagccccatggtatcttaacgctgataagccg
agtttgaagcatcaacggaattggaaatcggacccgaactacaccaagtcatggtacgat
aggggtgctaagctttttcaggctaacaagtacaggaaaggagcttgtgagaactgtgga
gccatgactcatgacaagaagtcatgcatggaacgacctcgcagtgtgggagctaaatgg
actaacatcaatatagcaccagatgagaaagtggagtcatttgaactggattatgatgga
aagcgtgatcgctggaacggttacgacccatcgacgtacacccgtgttattgcagattat
gaagctagagaagaggctaggaaaaagtatctgaaagagcaacagctcaagaaacttgag
gagaaggatggtgaggagggtgacgagaacgtggctagtgaggaggaggatgaagaagat
ggtttgaagatagatgaggctaaagttgatgagagtgctcaaatggattttgctaaggta
gagaagcgtgtacgtacaacaggtggtggaagcactggaactgtgaggaatttgcgtatt
agggaagacactgcaaagtatcttctgaaccttgatgtgaactctgcatactatgatcca
aaaacccgctccatgcgtgaagatccattgccagatgcagaccccaatgataaattctat
gtgggtgataaccaaaatcgacttagcggacaagctctggagttcaagcaactcaacata
catgcgtgggaagcttttgataagggacaggatattcacatgcaagctgccccatctcaa
gctgaacttctattcaagagttttaagatcaaaaaggagaaattgaaatctgaaaacaaa
gataagattatggagaagtatgggaatgctgcatctgaagaaccaatccctcgggagctt
cttcttggacaaagtgaaaaagagattgaatatgaccgaactggtcgaataatcaaagga
caggatgtagcccttcccaagagcaaatatgaagaggatgttttcattaataaccataca
accgtatggggctcatggtggaaagatcatcagtggggctacaaatgctgcaagcagact
atccgaaatagctactgcactggcttagctggaattgaggctgctgaagcatcggctgat
ttgatgaaggcaaatatggcccgcaaggaagctgcagaagatgagcctgtacgacatgaa
gaaaagcgactggccacctggggaactgatgtgcctaatgatattgttcttgacaagaag
ctgcttgatgaagccctaaagaaggagggtgcgaggaggaaagaggagatggatgaaagg
aagaggaagtacaatgtgaaatggaatgatgaggtcaccgcggaagacatggaggcttac
cgcatgaagagaattcaccatgatgatcctatgagggatttcctccattag

DBGET integrated database retrieval system