KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344696
Entry
4344696           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L34
  KO
K02915  large subunit ribosomal protein L34e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4344696
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4344696
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4344696
  Archaea
    4344696
SSDB
Motif
Pfam: Ribosomal_L34e
Other DBs
NCBI-GeneID: 4344696
NCBI-ProteinID: XP_015650819
UniProt: Q6ZD96 A0A0P0XBX8
LinkDB
Position
8:3293116..3295956
AA seq 118 aa
MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA
EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAFLVEEQKIVKKVLKIQKTKDKSAK
NT seq 357 nt   +upstreamnt  +downstreamnt
atggtgcagcggctgacctaccggaagcggcacagctacgccacgaaatccaaccagacc
cgcgtcgtcaagacccccggtgggaggcttgtgtaccagtacaccaagaagcgggcgagc
gggccgaaatgcccagtcaccgggaagaagatccaaggaattccacacctgagacctgct
gagtacaagaggtccagattgtcaaggaatcgcaggaccgtgaaccgtccttacggtggt
gtcctgtctggtactgcagtcagagagaggatcatccgggcttttttggtcgaggagcag
aagattgtgaagaaggtgttgaagatccagaagaccaaggacaagtcagctaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345669
Entry
4345669           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L34
  KO
K02915  large subunit ribosomal protein L34e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4345669
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4345669
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4345669
  Archaea
    4345669
SSDB
Motif
Pfam: Ribosomal_L34e
Other DBs
NCBI-GeneID: 4345669
NCBI-ProteinID: XP_015648394
UniProt: Q0J5G1
LinkDB
Position
8:complement(21221236..21223061)
AA seq 118 aa
MVQRLTYRKRHSYATKSNQTRVVKTPGGRLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA
EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAFLVEEQKIVKKVLKIQKTKDKTAK
NT seq 357 nt   +upstreamnt  +downstreamnt
atggtgcagcggctcacctaccggaagcgtcacagctacgcgactaagtcgaaccagacc
agggtcgtcaagaccccaggtgggaggcttgtgtaccagtacacgaagaagagggcgagc
gggccgaagtgccccgtcaccgggaagaagatccaggggattccccacttgaggcctgct
gagtacaagaggtccaggttgtctaggaaccgcaggactgtgaaccgtccatatggtgga
gtgctctctggaactgcagttagggaaaggatcatccgtgctttcttggtcgaggagcag
aagattgtcaagaaggtcctgaaaatacagaaaaccaaggacaagaccgcaaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267671
Entry
9267671           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L34
  KO
K02915  large subunit ribosomal protein L34e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9267671
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9267671
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    9267671
  Archaea
    9267671
SSDB
Motif
Pfam: Ribosomal_L34e
Other DBs
NCBI-GeneID: 9267671
NCBI-ProteinID: XP_015651340
UniProt: A3BYS9
LinkDB
Position
9:complement(14691168..14693153)
AA seq 119 aa
MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA
EYKRSRLSRNRRTVNRPYGGVLSGTAVRERIIRAFLVEEQKIVKKVLKIQKTKDKSASK
NT seq 360 nt   +upstreamnt  +downstreamnt
atggtgcagcgcctgacgtaccgcaaaaggcacagctatgccacgaagtctaatcagacg
cgggtcgtcaagactccaggtggcaagctcgtgtaccagtacaccaagaagagggcgagc
gggcccaagtgccccgtgaccgggaagaagatccagggaattccccatctcaggcctgct
gagtacaagagatccaggttgtctaggaaccgcagaactgtgaaccgtccctatggtgga
gtgctctctggaactgcagttagggaaaggatcattcgtgctttcttggttgaagagcag
aagattgtgaagaaagtcttgaaaatacagaaaaccaaggacaagtcagcctcaaagtag

DBGET integrated database retrieval system