KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344854
Entry
4344854           CDS       T01015                                 
Name
(RefSeq) phosphoribosylamine--glycine ligase isoform X1
  KO
K01945  phosphoribosylamine---glycine ligase [EC:6.3.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00048  De novo purine biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4344854
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     4344854
SSDB
Motif
Pfam: GARS_A GARS_N GARS_C CPSase_L_D2 ATP-grasp ATP-grasp_3 ATP-grasp_2 ATP-grasp_5 ATP-grasp_4 RimK
Other DBs
NCBI-GeneID: 4344854
NCBI-ProteinID: XP_015651104
UniProt: A0A0N7KPE2 Q6YZX5
LinkDB
Position
8:5341422..5345399
AA seq 527 aa
MASAAAAYGVGAPLKLAARRHGALALAGSHRCSGWKSSVSCPVPQAWMGSCSSVAMRRVA
SGSRLIVQASNSGGSSLKASLADASLLTEERITVLVIGGGGREHALCYALNRSPSCDAVL
CAPGNAGIAQSGDATCISDLDVSDSDAVIAFCCKRGVGMVVVGPEAPLVAGLVNDLVKAE
IPAFGPSSEAAALEGSKDFMKKLCDKYNIPTAKYRTFTDPAEAKQYVKDQGAPIVVKADG
LAAGKGVVVAMTLDEAFEAIDSMLVQGSFGSAGSRVIIEEYLEGEEASFFALVDGENALP
LESAQDHKRVGDGDVGPNTGGMGAYSPAPIVTEELKHTIMDSIIIPTVQGMAAEGCKFVG
VLYAGLMIEKKSGLPKLIEYNVRFGDPECQVLMMRLESDLAQVLMSACRGELGDVSLTWS
PEMAMVVVMASEGYPGSYKKGTVIRNLEKAEQVSPAVKIFHAGTALDGDGNLVAVGGRVL
GITAKGKDIEEARARAYDAVDVVDWPEGFFRRDIGWRALKHKQVANY
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggcgtctgctgctgccgcttacggcgtcggggctccactcaagctcgctgcaaggcgg
catggggcactcgcgctggccggtagccatcgctgcagtggatggaagtcttcagtgtct
tgccctgttcctcaggcttggatgggcagttgctcttctgtcgcaatgcgccgtgtcgcc
tccggttctcgattgattgttcaggcttcaaacagcgggggctcaagcttgaaggcatca
ttggctgatgctagcctgcttactgaagagaggataactgttttggtgattggaggtgga
ggaagggagcacgctctctgttacgccttgaatcgctctccgtcttgtgatgcggtccta
tgtgcccctgggaacgcaggtattgctcagtctggagatgcgacctgtatatcggactta
gacgtctccgatagcgatgccgttatcgcgttctgctgcaagaggggagtgggaatggtt
gtagtaggtcctgaagctcctcttgttgccggtcttgtgaatgaccttgtgaaagctgag
ataccagcatttggtccttcctcagaagctgcggctttagaaggatcgaaggactttatg
aagaaattatgcgataagtacaatattcctacagctaagtatcgcacattcacagatcct
gcagaagctaaacaatatgtcaaagatcaaggcgcccctattgttgtcaaagctgatgga
ttggcagctggaaaaggcgtggttgttgctatgactttggatgaggcatttgaagccata
gactctatgctggttcaagggtcatttggttctgctggttcacgggttatcattgaagaa
tatctggagggtgaagaagcctctttctttgcattagtggatggtgaaaatgcattgcca
cttgaatcggcacaagatcacaaaagggttggtgatggtgatgtaggcccaaatactggt
ggtatgggtgcatattcccctgcaccaatagtgacagaagagcttaagcacacaattatg
gatagtataataatcccaacagttcaaggtatggcagctgaaggatgcaagtttgttggt
gtattatatgctggacttatgattgagaagaaatctggtctgcctaagcttatcgagtac
aacgtacgattcggtgacccagaatgccaggttcttatgatgcgattagaatccgatcta
gcacaggttctgatgtctgcgtgcagaggggaactgggcgatgtttcactaacctggtca
cctgaaatggcaatggtggttgtgatggcaagcgaaggataccccggatcttataagaag
gggactgtaataagaaatctcgagaaggccgagcaggtctcgcccgcggtaaaaatattc
catgctggaacagcactggatggggatggaaatcttgtcgctgtcggaggccgggtgctc
gggatcacggctaagggcaaagacattgaggaagcacgggcaagagcatatgatgcagta
gatgttgttgactggcctgaaggattcttcaggcgcgatattggttggagagcactgaag
cacaagcaagtggccaattactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351721
Entry
4351721           CDS       T01015                                 
Name
(RefSeq) phosphoribosylamine--glycine ligase isoform X1
  KO
K01945  phosphoribosylamine---glycine ligase [EC:6.3.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00048  De novo purine biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4351721
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     4351721
SSDB
Motif
Pfam: GARS_A GARS_N GARS_C ATP-grasp ATP-grasp_3 CPSase_L_D2 ATP-grasp_2 ATP-grasp_4 RimK ATP-grasp_5 Dala_Dala_lig_C
Other DBs
NCBI-GeneID: 4351721
NCBI-ProteinID: XP_015618875
UniProt: Q2QWF3 Q0IPI9
LinkDB
Position
12:complement(5013787..5018373)
AA seq 518 aa
MACAASSVKGSLNVGGAKAFSNNLFRDYLKSSVSYPVSEISSPIRAQHVAYGSNLIVRGS
KSRDFSSKLASTNGSSKISEERVTVLVIGGGGREHALCYALERSPSCDAVFCAPGNSGIA
QSGDATCIPDLDISNSDAVISFCRNWGVGLVVVGPEAPLVAGLANELVKAGIPTFGPSSE
AAALEGSKDFMKKLCDKYHIPTAKYQSFTDPSDAKKYVEEQGAPIVVKADGLAAGKGVVV
AMTLEKAFEAIDSMLVEGSFGSAGSRVIVEEYLEGEEVSFFALVDGETALPLESAQDHKR
VGDGDVGPNTGGMGAYSPAPIVTEKLKCKVMESIIVPTVKGMATEGCKFVGVLYAGIMIE
KKSGLPKLIEYNVRFGDPECQVLMMRLQSDLAQVLLAACRGELGSVSLTWSPELATVVVM
ASEGYPGVYKKGTVIKNIDEAEQVSPAVKIFHAGTALDRDGNFVAAGGRVLGVTAKGKDI
EEARAKAYDALDVVDWPEGFFRHDIGWRAQKYRRMVAH
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggcatgtgctgcttcgagtgtaaaaggttctctcaacgttggaggagctaaggcattc
agcaataatttgtttcgtgattacttgaaatcttcggtgtcttatcccgtttcagagatt
tcttctcccatcagagcgcaacatgtagcatatggttcgaatctcattgttaggggttct
aagagcagggactttagctcgaagctcgcatcgacaaacggcagctcgaagatttctgaa
gagagggtaactgtattggtcattggtggaggaggaagggagcatgctctttgttatgcc
ttggagcgctctccatcctgtgatgcagtcttctgtgcccctggtaactctggcattgct
caatctggagatgctacatgtataccggacctggacatatcgaacagcgacgcggtcatc
tcgttctgtcgcaactggggagtcgggttggttgtagttgggcctgaagcaccccttgtt
gctggccttgcaaatgagcttgtcaaagctgggatacctacttttggtccttcatcagag
gctgcagcgttagaagggtcaaaagacttcatgaagaagttgtgtgataagtaccacatt
cccaccgcaaagtaccaatctttcacagatccttcagatgctaagaaatatgttgaggag
caaggagcccctattgttgttaaagccgatggattggcagctgggaaaggtgtagttgtt
gctatgactttggaaaaggcatttgaagcaatagactctatgctggttgaaggttcattc
ggttctgctgggtcacgggtaatagttgaagaatatttagagggggaggaggtttctttc
tttgctctagtggatggagaaactgctttgcctcttgaatcagcccaggaccataaaaga
gttggtgatggcgatgttggtccaaatacaggtggtatgggtgcatactcccctgcacca
atagtgacggaaaaactcaagtgcaaagtgatggagagcatcattgtcccgactgttaaa
ggtatggcaactgaaggatgcaagttcgtcggtgtgttgtatgctgggatcatgattgag
aagaaatcgggactgccaaagcttattgaatacaatgtgcgatttggtgatccagaatgt
caggttctgatgatgcggttacaatccgacctcgcacaggtcttgcttgctgcatgtagg
ggagaactggggtcagtctcactaacctggtcgcctgaattggcaactgtggttgtgatg
gcaagtgaaggttaccctggtgtttacaagaaggggacagtaataaaaaatatcgatgaa
gctgagcaggtctctcctgcagttaagatctttcatgctggaactgccctagatcgagat
ggaaacttcgtcgcggcaggaggccgtgttcttggtgtaaccgcgaaaggtaaggacatt
gaggaagcaagggcaaaagcatatgacgctctcgacgttgtcgactggccagaaggattt
ttcaggcatgacattggttggagagcacagaaatatcggcgcatggttgcacactga

DBGET integrated database retrieval system