KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344972
Entry
4344972           CDS       T01015                                 
Name
(RefSeq) ethanolamine-phosphate cytidylyltransferase
  KO
K00967  ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00440  Phosphonate and phosphinate metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Module
osa_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4344972
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    4344972
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.14  ethanolamine-phosphate cytidylyltransferase
     4344972
SSDB
Motif
Pfam: CTP_transf_like FAD_syn
Other DBs
NCBI-GeneID: 4344972
NCBI-ProteinID: XP_015650484
UniProt: A0A0P0XD69
LinkDB
Position
8:7605600..7610210
AA seq 430 aa
MMMGLLAFESNQGLWNSGYYSQLFGIGGVMVTVAILWLSTGYFGGIGAPFAPYFWPYLAQ
LPKKKERKRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPVLS
MEERLTLVSGLKWVDEVIPNAPYEITEEFMNTLFNKYNIDYIIHGDDPCLLPDGTDAYAL
AKKVGRYKQIKRTEGVSSTDIVGRILLTFKQKEAGSMEATTDANVAVNQNTGADTYDKVK
SQLSNFLPTSRRIMQFSNGQAPLPGARVVYIDGAFDLFHAGHVEILRSARQLGDFLLVGV
HDDQAIRDRRGYRPIMHLHERTLSVLACRYVDEVIIGAPWEVSRDMITTFNISLVVHGTV
TEGSSVVGIDPYAVPKSMGIFQTITSPKPITTVSVATRIIDNHEAYKKRNLKKKASEDRY
YTQKKFVSGD
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgatgatgggtttgctagcgtttgagagcaaccaagggctctggaatagtggatattat
tcccagctgtttgggattggaggagttatggtcactgttgccattctttggttatcgaca
ggctactttggaggaattggtgctccttttgccccatatttttggccatatctagcacaa
cttccaaagaagaaggaacggaaaaggcctgtgagagtgtacatggatggatgctttgac
ctcatgcattatggccatgcaaatgcattacggcaggccaagttgttgggagatcaactt
gtagtgggagttgttagtgatgaggagattgtggcgaacaagggtccacctgtgctttca
atggaagagaggttgacacttgttagtggattgaagtgggtggatgaggtcattcccaac
gcgccctatgagatcacggaagaatttatgaataccctcttcaataaatataacattgat
tacattatacatggagatgatccttgtcttctacctgatggaacggatgcttatgcgttg
gcaaagaaggttggacgctacaagcaaatcaaacgcactgaaggtgtctcaagcactgat
atagtcgggaggatactactgacattcaagcagaaagaagctggcagtatggaagctacc
acagatgcaaatgttgctgtcaatcagaacactggagctgatacatatgataaagtgaaa
agtcagctatccaattttcttccaacatctcgccggataatgcagttttcaaatggacag
gctcctttgccaggtgctcgcgttgtgtatatagatggtgcttttgacctttttcatgcc
ggccatgttgagatcctcagaagtgctaggcaacttggtgacttccttcttgttggtgtc
catgatgaccaggcaatcagggatagaagagggtatcgtcctatcatgcacctccacgag
cgtactcttagtgtacttgcatgtcgctatgttgatgaagttataataggcgccccatgg
gaggtttcaagggatatgatcactacatttaacatttcattggttgtgcatgggacagta
accgagggtagttctgtggtcggtattgatccatacgccgttccaaagagcatgggtatc
ttccaaacaatcacaagccccaaacctataacaacagtttcagttgctaccagaataatt
gataaccatgaagcttacaagaaaaggaacttgaaaaagaaggcaagcgaagatagatac
tacacacaaaagaaatttgtctctggagattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348512
Entry
4348512           CDS       T01015                                 
Name
(RefSeq) ethanolamine-phosphate cytidylyltransferase
  KO
K00967  ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00440  Phosphonate and phosphinate metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Module
osa_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4348512
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    4348512
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.14  ethanolamine-phosphate cytidylyltransferase
     4348512
SSDB
Motif
Pfam: CTP_transf_like FAD_syn
Other DBs
NCBI-GeneID: 4348512
NCBI-ProteinID: XP_015614982
UniProt: Q338R8 Q0IY04
LinkDB
Position
10:complement(12755445..12759605)
AA seq 425 aa
MMMGLLAFESNQGLWNSGYYSQLFGIGGVMVTVAILWLSTGYFGGIGAPFAPYFWPYLGQ
LPKKKERKRPVRVYMDGCFDLMHYGHANALRQAKLLGDQLVVGVVSDEEIVANKGPPVLS
MEERLTLVSGLKWVDEVIPNAPYEITEEFMNTLFNKYNIDYIIHGDDPCLLPDGTDAYAL
AKKVGRYKQIKRTEGVSSTDIVGRILLTFKQKEAGSMETTTDANQNTGATCDKVKSQLSN
FLPTSRRIMQFSNGQAPSPGARVVYIDGAFDLFHAGHVEILRSARQLGDFLLVGVHDDQA
IRDRRGYRPIMHLHERTLSVLACRYVDEVIIGAPWEVSRDMITTFNISLVVHGTVTEGSS
VVGIDSYAVPKSMGIFQTITSTKPITTVSVATRIIDNHEAYKKRNLKKKASEDRYYTQKK
FVSGD
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgatgatgggtttgctagcgtttgagagcaaccaagggctctggaatagtggatattat
tcccagctgtttgggattggaggagttatggtcactgtcgccattctttggttatcgaca
ggctactttggaggaattggtgctccttttgccccatatttttggccatatctaggacaa
cttccaaagaagaaggaacggaaaaggcctgtgagagtgtacatggatggatgctttgac
ctcatgcactatggccatgcaaatgcattacggcaggccaagttgttgggagatcaactt
gtagtgggagttgttagtgatgaggagattgtggcgaacaagggtccacctgtgctttca
atggaagagaggttgacacttgttagtggattgaagtgggtggacgaggtcattcccaac
gcgccctatgagatcacggaagaatttatgaataccctcttcaataaatataacattgat
tacattatacatggagatgatccttgtcttctacctgatggaacggatgcttatgcgttg
gcaaagaaggttggacgctacaagcaaatcaaacgcactgaaggtgtctcaagcactgat
atagtcgggaggatactactgacattcaagcagaaagaggctggcagtatggaaactacc
acagatgcaaatcagaacactggagcaacatgtgataaagtgaaaagtcagctatccaat
tttcttccaacatctcgccggataatgcagttttcaaatggacaggctccttcgccaggt
gctcgcgttgtgtatatagatggtgcttttgacctttttcatgccggccatgttgagatc
ctcagaagtgctaggcaacttggtgacttccttcttgttggtgtccatgatgaccaggca
atcagggatagaagagggtatcgtcctatcatgcacctccatgagcgtactctcagtgta
cttgcatgtcgctatgttgatgaagttataataggtgccccatgggaggtttcaagggat
atgattaccacatttaacatttcattggttgtgcatgggacagtaaccgagggtagttct
gtggtcggtattgattcatacgctgttccaaagagcatgggtatcttccaaacaatcaca
agcaccaaacctataacaacagtttcagtggctaccagaataatcgataaccatgaagct
tacaagaaaaggaacttgaaaaagaaggcaagcgaagatagatactacacacaaaagaaa
tttgtctctggagattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349636
Entry
4349636           CDS       T01015                                 
Name
(RefSeq) ethanolamine-phosphate cytidylyltransferase
  KO
K00967  ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00440  Phosphonate and phosphinate metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Module
osa_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4349636
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    4349636
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.14  ethanolamine-phosphate cytidylyltransferase
     4349636
SSDB
Motif
Pfam: CTP_transf_like Oxidored_molyb
Other DBs
NCBI-GeneID: 4349636
NCBI-ProteinID: XP_015617668
UniProt: A0A0N7KSC9
LinkDB
Position
11:complement(1071267..1076822)
AA seq 424 aa
MEAGAGSSSAKLVAACVIGGIVLGASVVALHLAGPVAIPALPPVDALRRRFRRGRRRPVR
VYMDGCFDMMHYGHCNALRQARALGDELIVGVVSDHEITANKGPPVTPLHERLIMVRAVK
WVHDVIPDAPYAITEDFMNKLFNEYNIDYIIHGDDPCLLPDGTDAYALAKKVGRFKQIKR
TEGVSTTDIVGRMLLCVRERSASDSHNHSSLQRQFSHGHGQKIDDSGSGSGTRISHFLPT
SRRIVQFSNSRGPGPDSRIVYIDGAFDLFHAGHVEILRLARELGDFLLVGIHTDQTISST
RGPHRPIMNLHERSLSVLACRYVDEVIIGAPWDVSKDMITTFNISLVVHGTIAENMDFMK
DDLNPYAVPRAMGIYRRLESPLDITTSTIIRRIVANHEAYQKRNEKKEASEKKYYDSKSF
VNGE
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggaggcgggggcggggagcagcagcgccaagctggtggcggcgtgcgtcatcggcggg
atcgtgctgggggcatccgtggtcgcgctccacctcgccggccccgtcgccattcccgcc
ctgccgcccgtcgacgcgctccgccgccggttccgccgcggacgacggcgccccgtgcgc
gtctacatggatggctgcttcgacatgatgcactacggccactgcaacgcgctgcgccag
gcgcgcgccctcggggacgagctcatcgtcggcgttgtcagcgaccacgagatcaccgcc
aacaagggcccgccggtcacgcccctccacgagaggttgataatggtccgtgctgtaaaa
tgggtacacgatgttattccagatgcaccttacgccataactgaggatttcatgaataaa
ttattcaatgagtataatatagattatatcatccatggcgatgatccttgtctgctccca
gatggtactgatgcatatgctcttgccaaaaaggttggtcgatttaaacagattaaaaga
accgaaggagtgtcaacgacagacattgttggaagaatgcttctttgtgttagagagaga
tcagcttctgatagtcacaaccactcttcactacaaaggcagttcagtcacgggcatggc
cagaaaattgatgatagtggatctggaagtggaactaggatatctcattttcttcctaca
tctcggagaatagttcagttctcaaatagcaggggtccaggtccagattctcggatagtg
tacatagatggtgcatttgatctattccatgctggacatgttgagatattgcgcctcgct
cgagagcttggagatttcctgcttgtgggtattcacacagaccagactataagttcaaca
agaggaccacatcgcccaatcatgaacctccatgagagaagtttgagtgttttggcttgc
cgttatgttgatgaagtgatcattggtgctccatgggatgtttcgaaagatatgattacc
acatttaatatttcgttggttgttcatgggacaattgctgagaatatggactttatgaag
gatgatttaaatccatatgctgttccaagggctatgggcatctaccgtagactggagagc
cctttagacatcactactagtactatcataaggaggatagttgctaaccatgaagcctac
cagaaacggaacgagaagaaagaagccagtgagaagaagtactacgacagtaaaagcttt
gtcaatggagagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351359
Entry
4351359           CDS       T01015                                 
Name
(RefSeq) ethanolamine-phosphate cytidylyltransferase
  KO
K00967  ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00440  Phosphonate and phosphinate metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Module
osa_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4351359
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    4351359
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.14  ethanolamine-phosphate cytidylyltransferase
     4351359
SSDB
Motif
Pfam: CTP_transf_like
Other DBs
NCBI-GeneID: 4351359
NCBI-ProteinID: XP_015620755
UniProt: Q2QYF8 A0A8J8XX73
LinkDB
Position
12:complement(1001327..1011150)
AA seq 424 aa
MEAGAGSSSAKLVAACVIGGIVLGASVVALHLAGPVAIPALPPVDALRRRFRRGRRRPVR
VYMDGCFDMMHYGHCNALRQAHALGDELIVGVVSDDEITANKGPPVTPLHERLIMVRAVK
WVHDVIPDAPYAITEDFMNKLFNEYNIDYIIHGDDPCLLPDGTDAYALAKKVGRYKQIKR
TEGVSTTDIVGRMLLCVRERSASDSHNHSSLQRQFSHGHGQKIDDSGSGSGTRISHFLPT
SRRIVQFSNSRGPGPDSRIVYIDGAFDLFHAGHVEILRLARELGDFLLVGIHTDQTISST
RGPHRPIMNLHERSLSVLACRYVDEVIIGAPWDVSKDMITTFNISLVVHGTIAENMDFMK
DDLNPYAVPRAMGIYRRLESPLDITTSTIIRRIVANHEAYQKRNEKKEASEKKYYDSKSF
VNGE
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggaggcgggggcggggagcagcagcgccaagctggtggcggcatgcgtcatcggcggg
atcgtgctgggggcgtccgtggtcgcgctccacctcgccgggcccgtcgccattcccgcc
ctgccgcccgtcgacgcgctccgccgcaggttccgccgcggacgccgacgtcccgtgcgc
gtctacatggatggctgcttcgacatgatgcactacggccactgcaacgcgctgcgccag
gcgcacgccctcggggacgagctcatcgtcggcgttgtcagcgacgacgagatcaccgcc
aacaagggcccgcccgtcacgccgctccacgagaggttgataatggtccgtgctgtaaaa
tgggtgcacgatgtcattccagatgcaccttacgccataactgaagattttatgaataaa
ttattcaatgagtataatatagattatatcattcatggcgatgatccttgtctgctccca
gatggtactgatgcatatgctcttgccaaaaaggttggtcgatataagcagattaaaaga
accgaaggagtgtcaacgacagacattgttggaagaatgcttctttgtgttagagagaga
tcagcttctgatagtcacaaccactcttcactacaaaggcagttcagtcacgggcatggc
cagaaaattgatgatagtggatctggaagtggaactaggatatctcattttcttcctaca
tctcggagaatagttcagttctcaaatagcaggggtccaggtccagattctcggatagtg
tacatagatggtgcatttgatctattccatgctggacatgttgagatattgcgcctcgct
cgagagcttggagatttcctgcttgtgggtattcacacagaccagactataagttcaaca
agaggaccacatcgcccaatcatgaacctccatgagagaagtttgagtgttttggcttgc
cgttatgttgatgaagtgatcattggtgctccatgggatgtttcgaaagatatgattacc
acatttaatatttcgttggttgttcatgggacaattgctgagaatatggactttatgaag
gatgatttaaatccatatgctgttccaagggctatgggcatctaccgtaggctggagagc
cctttagacatcactactagtactatcataaggaggatagttgctaaccatgaagcctac
cagaaacggaacgagaagaaagaagccagtgagaagaagtactacgacagtaaaagcttt
gtcaatggagagtaa

DBGET integrated database retrieval system