KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345056
Entry
4345056           CDS       T01015                                 
Name
(RefSeq) bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial
  KO
K19562  bifunctional dethiobiotin synthetase / adenosylmethionine---8-amino-7-oxononanoate aminotransferase [EC:6.3.3.3 2.6.1.62]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00780  Biotin metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Module
osa_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    4345056
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.62  adenosylmethionine---8-amino-7-oxononanoate transaminase
     4345056
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.3  dethiobiotin synthase
     4345056
SSDB
Motif
Pfam: Aminotran_3 AAA_26
Other DBs
NCBI-GeneID: 4345056
NCBI-ProteinID: XP_015650723
UniProt: Q6ZKV8
LinkDB
Position
8:complement(8879943..8888188)
AA seq 821 aa
MLRLLRHARRHSTSSSSSAAAAAVPLTSPAFAVFGANTGVGKTLVSAGLVASLLASPSPS
PSTVAYLKPLQTGFPDDSDARFVFDRAPALLRRLRLAGGGASTRLVASNHTLFPSPAVDP
LPERQDTVVNYGGEEGVEEKALVCRTVYAWREPVSPHLAAEREGMPVEDEEVRWLVDRWL
AEEDGGGEVWKVLETAGGVASPGPSGTLQCDLYRSSRLPAVLVGDGRLGGISSTLSAYET
LLLRGYDVGSVILEDRGLSNDRFLLSYLRKRVPVHVLPPIPEDPKDDLTDWFSESSSAFS
SLKDSLQSFHSRRVQRLNSMQRKSKYLLWWPFTQHDLVPVDSVTVIDSRFGENFSAYKVK
DKTIVPQFDACASWWTQGPDSNLQIELARDMGYAAARYGHVMFPENVHEPALRCAELLLG
GVGKDWASRVYFSDNGSTAIEIALKMAFRKYACDHGIIVDSEKDIRSEGSVHFKVLALNG
SYHGDTLGAMEAQAPSAYTSFLQQPWYSGRGLFLDPPTVYIKNKSANLSLPPSIMHDQLS
SCDTCFSSLTEVFCKTRDTSSAANVYVSYISQQLSQYAMSNNSEHIAALIIEPVIQGAGG
MHLIDPLFQRLLVKECKNRKIPVIFDEVFTGFWRLGVESASELLGCFPDISCYAKLMTGG
IVPLAATLATEPIFEAFRSDSKLTALLHGHSYTAHPMGCTAAVKAIQWYKDPSTNSNIDL
DRMKLKELWDSALVNHLSSLPNVKRVVSLGTLCAIELKAEGSDAGYASLYASSLIRQLRE
EDNIYARPLGNVIYLMCGPCTTQDSCTRQLAKVHRRLQKLN
NT seq 2466 nt   +upstreamnt  +downstreamnt
atgctccgcctcctccgccacgctcgccgccactccacctcctcctcctcctccgccgcc
gccgccgccgtgcccctcacctcgccggccttcgccgtcttcggcgccaacacgggcgtc
ggcaagacgctcgtctccgcgggcctcgtcgcctcccttctcgcctccccctccccttcc
ccttccaccgtcgcctacctcaagccgctccagaccggcttccccgatgactccgacgcg
cgcttcgtcttcgaccgggcccccgcgctcctccgccgcctccgcctcgccggcggcggc
gcctccacccgcctcgtcgcgtccaaccacaccctcttcccttcccccgccgtggatccc
ctccccgagcgccaggacacggtggtgaactacggcggtgaggagggggtggaggagaag
gcgctcgtgtgcaggacggtgtacgcgtggcgggagcccgtgtcgccgcacctggcggcg
gagagggaggggatgccggtggaggacgaggaggtcaggtggctcgtggaccggtggctg
gcggaggaggacgggggtggggaggtgtggaaggtgctcgagacggccggcggcgtcgcc
agccctggcccttctggcacgctccaatgtgatctctatcggtcctctaggttacctgca
gttcttgttggagatggtcgtctaggtggtatttcatctactttatctgcctacgaaact
ctgttgctcagaggatatgatgtgggctcagttattttggaagatcgtggcttgtcgaat
gacagattcctgctctcatacttgagaaagagggtacctgtgcatgtcctgccaccaatt
cctgaggatcccaaagacgacctaactgattggttttctgagtcatcctcagcttttagt
tcacttaaagatagtctgcaatcttttcattcacgaagagttcaaaggctaaacagtatg
cagagaaaatcaaagtatttgttgtggtggcctttcactcagcatgatcttgtacctgta
gattctgttacagttattgattcgcgttttggtgagaatttctcagcatacaaggttaaa
gacaaaacgattgttccccagtttgatgcatgtgctagttggtggacacaaggacctgat
tctaacttacagattgaacttgcaagagatatgggttatgctgctgcaaggtatggtcat
gtgatgtttccagagaatgttcatgaacctgctcttcgttgtgcagaacttttgcttggt
ggtgttggtaaagattgggcttctcgagtttatttttcagacaatggatctactgcaatt
gaaattgctttgaagatggcatttcgtaaatatgcatgtgaccatgggattatagtggac
agcgaaaaagatatcagaagtgaaggaagtgttcattttaaggtccttgctttaaatggt
tcctaccacggggatactttgggtgctatggaagcacaagctccatcagcttacacatct
tttcttcagcagccatggtactcggggcgaggactttttctagatcctcctacagtgtac
attaaaaacaaaagcgccaacctttctcttcccccatcgataatgcatgatcaactgagt
tcttgtgatacatgtttttcctcattaactgaagttttttgcaagaccagggacacatcg
tctgctgctaatgtatatgtttcatacatatcacaacaactatcacagtatgctatgtca
aataattcagagcatattgcagcattaattatagagccagtaatacaaggtgcaggggga
atgcatttgatagatccccttttccagagattacttgtcaaagagtgtaaaaatcgaaaa
attcctgtcatatttgatgaggtatttacaggattttggcgtctcggtgtggagtctgct
tcagagttgcttggctgttttcctgatatctcttgttatgctaaattgatgactggtggc
attgtaccattggctgcaactttagctacagagcctatttttgaagccttcagaagtgac
tctaagctaacagcactcttgcatggccattcctataccgcgcatcccatgggctgtacc
gcagcagtaaaagctatccaatggtataaagatccctccaccaattcaaatattgatctt
gatcgtatgaagctgaaggagctatgggatagtgcactagtgaaccatttatcgtccctg
ccaaatgtgaaaagagtggtgtccttaggaactctgtgtgcaatcgagctaaaggctgag
ggatcagatgctgggtacgcatcactttatgcgagttccttaatccgacaacttcgtgag
gaggataacatctacgctcggcccctgggtaatgtgatataccttatgtgtggtccatgc
acaactcaagatagctgcactcgccagctcgccaaagtgcatcgtagacttcaaaagttg
aattga

DBGET integrated database retrieval system