KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345136
Entry
4345136           CDS       T01015                                 
Name
(RefSeq) nuclear nucleic acid-binding protein C1D
  KO
K12592  exosome complex protein LRP1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4345136
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4345136
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Exosome cofactors
     4345136
SSDB
Motif
Pfam: Sas10_Utp3
Other DBs
NCBI-GeneID: 4345136
NCBI-ProteinID: XP_015648663
UniProt: A0A0P0XEB0 Q6YX09
LinkDB
Position
8:10329425..10335440
AA seq 207 aa
MAAAAAADSTSAVPPAVVSAAEDTLAAAESVGDHLAEMVAAAGEDPDAIAELPPLRRARA
FLAMAKAAASLFAVRLRCSGVDPDEHPIKKEFERLSLWEEKLNRFEDWDKAPLRPTTTVN
TQAAARFIGHSLPHLTTDQKRSMQAISRGEGGSYSGNKRKPQPPRPNKKSVRAATEEFLA
KAALELSGHNDSKVKGPIRLLSDEDED
NT seq 624 nt   +upstreamnt  +downstreamnt
atggccgccgccgccgccgccgattccacttcggcggtgccacccgccgtggtgtccgcc
gccgaggacaccctcgcggccgccgagtccgtcggggaccacctcgccgagatggtcgcg
gcggcgggcgaggaccccgacgccatcgccgagctcccgccgctgcgccgcgcgcgcgcg
tttctcgccatggcgaaggccgccgcctccctcttcgcagtgcggcttaggtgttcggga
gttgatccggatgaacaccctatcaagaaggagtttgagaggttaagcttgtgggaggaa
aagttaaatcgatttgaggactgggacaaggcaccattgcgcccaaccactacagtgaat
acacaggcagcagcaaggttcattggtcactcattgccccatttgacaactgatcagaag
aggagcatgcaggcaatcagtagaggagaaggagggagttactctgggaacaagagaaaa
ccacaaccaccgcggccaaataagaagtctgttcgtgctgccacggaagaattccttgca
aaagcagctctggagcttagtgggcataatgatagcaaggtgaagggccctattaggctc
ctctctgatgaagatgaggactaa

DBGET integrated database retrieval system