KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345268
Entry
4345268           CDS       T01015                                 
Name
(RefSeq) 4-hydroxybenzoate polyprenyltransferase, mitochondrial
  KO
K06125  4-hydroxybenzoate polyprenyltransferase [EC:2.5.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4345268
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4345268
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.39  4-hydroxybenzoate polyprenyltransferase
     4345268
Prenyltransferases [BR:osa01006]
 Compound prenylation
  4HB prenyltransferase
   4345268
SSDB
Motif
Pfam: UbiA
Other DBs
NCBI-GeneID: 4345268
NCBI-ProteinID: XP_015648591
UniProt: Q0J6G2 Q6ZAH2
LinkDB
Position
8:complement(14078932..14082501)
AA seq 418 aa
MALLRAAAAADLLRRHRRAPLPLLLSALSPPPPTTPESCPDGPSPVAPYFAPPPPPLCRR
RRSWPPPPPPPRVSSSSYVGRGILLPATFSIYSPLSTSSSASPDGSPDEDSSPPHPSPAA
APPSSWVDRWLPQAARPYAMLARLDKPIGTWLLAWPCFWSISMAAMPGELPDMRMLALFG
CGAVLLRGAGCTVNDLLDRDIDNKVERTKSRPFASGILTPTQGVGFLGLQLLLGLGILLQ
LNNYSRILGASSLFLVFSYPLMKRFTFWPQAYLGLTFNWGALLGWAAIKESLDPAIILPL
YTAGICWTLVYDTIYAHQDKEDDLKVGVKSTALRFGDLTKHWISGFGVACIGSLALSGYS
ADLAWPYYPFLAAASAQLAWQISTVDLSDRLDCNRKFVSNKWFGALIFGGVLCGRLVS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggctctactccgagcagccgccgccgccgacctcctccgccgccaccgccgcgccccg
ctcccactcttactctccgctctctcgccgcctccaccgaccaccccggaatcctgcccc
gacggccccagtcccgtcgccccatacttcgctccgcctccgcctccgctatgccgccgc
cgtcgaagctggccgcctccgcctccgcctccgcgcgtctcgtcttcctcctacgtcggc
agggggatcctgctccccgcgaccttctcgatctactctcccctctctacctcctcctcc
gcctcccccgacggctccccggatgaggattcctcgccgccgcacccgtctcccgcggcg
gcgcctccgtcctcgtgggttgacaggtggctcccacaggcggcgcgcccctacgccatg
cttgcccgcctcgacaagcccatcggcacctggctcctcgcgtggccctgcttctggtca
atctcaatggcggcgatgccgggggagctgcctgacatgagaatgctggcactcttcgga
tgtggagccgtcctcctcagaggcgctggatgcacggtcaatgatcttcttgatcgagac
attgataacaaggttgagcgcaccaaaagcaggccttttgcatcaggcattctaacccct
acacaaggagtgggcttccttggattgcagcttttactgggattgggcattcttctccaa
ctaaataactatagccgtattcttggggcatcttcactttttttggtcttctcttatccc
ttgatgaagagattcacattttggcctcaggcgtatcttggcttgacctttaattgggga
gctttgttaggatgggctgccattaaagaaagcttagatcctgccatcatcctcccattg
tataccgctggtatatgctggacactcgtatatgataccatatatgcacatcaggacaaa
gaagatgacctcaaagtaggggtcaagtccacagcattaaggtttggagatttaacaaaa
cactggattagtggcttcggtgttgcatgcattggcagcttagcactcagtggctacagt
gctgaccttgcatggccttactatccttttctagctgctgcatctgcgcagttagcatgg
cagatttcaactgttgatttatctgaccgcctggattgcaacaggaaatttgtgtccaat
aagtggtttggcgctttgatatttggtggagttttatgtggacgacttgtatcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345469
Entry
4345469           CDS       T01015                                 
Name
(RefSeq) 4-hydroxybenzoate polyprenyltransferase, mitochondrial
  KO
K06125  4-hydroxybenzoate polyprenyltransferase [EC:2.5.1.39]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4345469
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4345469
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.39  4-hydroxybenzoate polyprenyltransferase
     4345469
Prenyltransferases [BR:osa01006]
 Compound prenylation
  4HB prenyltransferase
   4345469
SSDB
Motif
Pfam: UbiA FA_desaturase
Other DBs
NCBI-GeneID: 4345469
NCBI-ProteinID: XP_015649595
UniProt: A0A0P0XF65
LinkDB
Position
8:18371614..18379635
AA seq 417 aa
MAFLRAADLVRRHRRVPHASLILHPALLPPPPPPSMESFPDGPSTPGPVARNDIFAATLC
HRHRHRRWPRPLIPISSSSYDGSGARLPATVSLYSHLSSTSSGAGGDSTPPPQQSPQAKP
PPPSWVDRWVPLAARPYAMLARIDKPIGTWLLAWPSFWSIAMAAMPGELPDMRMLALFAC
GSVLIRGAGCTINDLLDRDIDRKVERTKSRPLASGILTPTQGVGFLGFQLLLGLPILLQL
NNLSQILGVFSLLLVFSYPLMKRFTYWPQAYLGLVFNWGALIGWAAMKGTIDPAIILPLY
TAGICWTLVYDTIYAHQDKEDDVKVGVKSTALRFGDSTKPWISGFGAACIANLALSGYNA
DLAWPYYPFLAAASAHLAWQVSTVDLSDRLDCNRKFVSNKWFGALIFGGILCGRLVS
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcgttcctccgcgccgccgacctcgtccgccgccaccgccgtgtcccgcatgctagt
ctgatcctccaccccgccctcttgccgccgccgccgccaccaagcatggagtccttcccc
gacggtcccagtactcctggccccgtcgcccgaaacgacatcttcgccgccacactatgc
caccgccaccgtcatcgccggtggccgcgtccgctaattccaatctcctcttcttcctat
gatggcagtggggcccggcttcccgcaaccgtgtcgttgtactcgcacctctccagcacc
agctcgggcgccggtggggattccacgcctcctccgcaacagtcgccgcaggcgaagcca
cctcctccgtcgtgggtggacaggtgggtcccactggcggcacggccatatgccatgctc
gcccgcatcgacaagcccattggcacctggctccttgcgtggcccagcttctggtcaatc
gcgatggcagcgatgccaggggagctgccggacatgaggatgctggcgctgttcgcgtgt
ggatccgtgctcatcagaggcgccggatgcacaatcaacgatcttcttgatcgagatatt
gatagaaaggttgagcgtaccaaaagcaggcctcttgcatcaggtattctaacacctacg
caaggagtgggtttcctcggattccagcttttactgggattaccaattcttctccaacta
aataacttaagccaaatacttggggtattttcacttcttttggtcttctcttatcccctg
atgaagaggttcacatattggcctcaggcatatcttggcttggtattcaactggggagct
ttgataggatgggctgccatgaaaggaaccatagatccagccatcatccttccgctgtat
acagctggtatatgctggacactggtgtatgataccatatatgcacatcaggataaagaa
gatgacgtcaaagtaggagtcaagtccacagcattaaggtttggagattcaaccaagccc
tggatcagtggatttggtgctgcatgcattgccaatttagcactcagtggctataatgct
gaccttgcatggccttactacccttttctggcagctgcatctgcgcacttagcatggcaa
gtttcaactgttgatttatctgaccgcctagattgcaacaggaaatttgtgtccaataag
tggtttggagctttgatatttggtggaattctatgtggacgacttgtatcatga

DBGET integrated database retrieval system