KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345269
Entry
4345269           CDS       T01015                                 
Name
(RefSeq) signal recognition particle subunit SRP68 isoform X1
  KO
K03107  signal recognition particle subunit SRP68
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4345269
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4345269
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4345269
SSDB
Motif
Pfam: SRP68
Other DBs
NCBI-GeneID: 4345269
NCBI-ProteinID: XP_015650620
LinkDB
Position
8:complement(14105811..14117873)
AA seq 593 aa
MSKPADQPPPSDMEVDAAAEEKPLVRFSINVLELMREAQMQHGLRHGDYTRYRRYCTARL
RRLYKSLKFLHGRGKYTKRNITESTVTDVRFLHIVFYMAERAWSHAMEKKTAGPNAQQRI
YMLGRFRKAVKWATLFSHLCSLKGDSRTSLEAEAYASYMKGTLLFEQEKNIEAAMTNFKN
TRAVYEELGKYGSIENQLLCRQRIEEVEPMIGFCSRKLGGSALQAHELLDLEKEGPAYDL
FKAKIEAVLSETRSQQAASMTEFSWLGRRFPITNAKTRVSILKAQQLEKDLNGANTESVP
ADKKLGIFDKIFSAYHDARSCIRNDLASAGNAENIRDELNGLDKAVSAVLGFRTIERNQL
LVSIAKSKFTKHRDEKNEKITKPEELVRLYDLLIQNTTDLTDLISSGRDKNKEENTFIQE
YELKSLAFRAERCFYLAKSYSSAGKRAESYALFCHARSITDSALQQLTNSPDKALVQDLK
ALSDSCRSNSFIEHATGIMEEENVPERLSKGVSTLSLGERKQAFLLDMLESYESALGESN
TKTPCRIARFPPPFQSVPCNPIVLDMAYNAIEFPNIENRMKKEKKGLLSRFWG
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgtcgaagcccgcggaccagcccccgccgtcggacatggaggtcgacgccgcggccgag
gagaagccgctcgtcaggttctccatcaacgtgctggagctcatgagggaggcgcagatg
cagcacggcctccgccacggcgactacacgcggtacaggagatactgtaccgcacgtctc
agaaggttatacaagtctctcaagtttctgcatggccgtggtaaatataccaagaggaat
ataacagagtcaacagtcacagatgtgaggtttctacacatagtattttatatggctgag
agagcatggagtcatgcgatggaaaagaaaactgctggtccaaatgcacaacagcgtatc
tacatgttaggtagatttagaaaagctgtcaaatgggcaacgcttttttcacatttatgt
tctctaaaaggagattccaggacgtctttggaagctgaggcatatgcttcatacatgaaa
ggtaccttgctgtttgagcaagagaagaacatagaggcagcaatgacaaatttcaagaac
accagggctgtatatgaggagcttgggaaatatgggagtatagaaaatcaacttttatgc
cgtcagcgcattgaggaagtggaacctatgattggattttgctctcgcaaactaggcgga
tcagctttgcaagcacatgaactactagatctggaaaaggaggggcctgcttatgatctt
ttcaaggctaagattgaggctgtattatctgagacaagatcgcagcaggcagcttccatg
accgagtttagctggcttggtcgcagatttccaattactaatgcaaagacccgtgtctcc
attttgaaagctcaacagctggagaaagacttgaatggtgcaaacacagaatcagttcca
gcggacaaaaaacttggcatttttgacaaaatattttctgcataccatgacgctcggagc
tgcatccgcaatgacttggcttctgctggcaatgctgagaatataagagatgaattgaat
ggtcttgacaaggctgttagtgctgtcttgggattcagaaccattgagcgaaaccaatta
ctcgttagtattgctaaaagcaagtttaccaagcaccgggatgagaagaatgagaaaatc
acaaaaccagaagaacttgttcggttgtatgatctgcttattcaaaatacaacagatctg
actgatttaattagctcaggaagggataaaaacaaggaagagaacacttttattcaggag
tatgagctgaaaagtttggctttccgagctgagagatgtttctatttggcaaagtcatac
agttcagccggtaaaagggctgaatcttacgcgctgttttgtcatgcccgttcaatcact
gattctgcactgcaacagctgactaacagtcctgacaaggccttagtccaagatcttaag
gctctttctgacagctgtagatccaatagcttcatagaacatgcgacaggtattatggag
gaagagaatgttcctgaaagactttcgaaaggtgtctcaacattgtcacttggtgaacga
aagcaggctttccttcttgatatgctagaaagctatgaatcagcactcggtgaatcaaat
accaaaacaccatgtcgcattgcacgattcccacctccattccaatcagttccgtgtaat
cctattgttcttgatatggcctacaatgcgatcgagttcccaaacattgagaacagaatg
aagaaggagaagaagggtcttctcagcagattctggggctga

DBGET integrated database retrieval system