KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345328
Entry
4345328           CDS       T01015                                 
Name
(RefSeq) bifunctional aspartokinase/homoserine dehydrogenase 1, chloroplastic isoform X1
  KO
K12524  bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00261  Monobactam biosynthesis
osa00270  Cysteine and methionine metabolism
osa00300  Lysine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
osa_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4345328
   00270 Cysteine and methionine metabolism
    4345328
   00300 Lysine biosynthesis
    4345328
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    4345328
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     4345328
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     4345328
SSDB
Motif
Pfam: Homoserine_dh AA_kinase NAD_binding_3 ACT ACT_7 DUF6323
Other DBs
NCBI-GeneID: 4345328
NCBI-ProteinID: XP_015650465
LinkDB
Position
8:complement(15439344..15450610)
AA seq 926 aa
MWSLAVASPHPAAAFAAARPRRGPRPAAAPSHRGVNPQRWRCEKTQAWSFWSSLWASDLP
GGLYGDVSKNMLKPAAAVSVEQAEASAHLPKGDMWSVHKFGGTCMGTSQRIQNVADIILR
DPSERKLVVVSAMSKVTDMMYNLVNKAQSRDDSYITALDEVFEKHMAAAKDLLGGEDLAR
FLSQLHADVSNLKAMLRAICIAGHATESFSDFVVGHGEIWSAQLLSFAIKKSGTPCSWMD
TREVLVVNPTGSNQVDPDYLESEKRLEKWFARQPAETIIATGFIASTPENIPTTLKRDGS
DFSAAIIGSLVKAGQVTIWTDVDGVFSADPRKVSEAVILSTLSYQEAWEMSYFGANVLHP
RTIIPVMKYNIPIVIRNMFNISAPGTMICQQPANESGDLEACVKAFATIDKLSLVNVEGT
GMAGVPGTASAIFGAVKDVGANVIMISQASSEHSVCFAVPEKEVAAVSAALHVRFREALS
AGRLSKVEVIHNCSILAAVGLKMASTPGVSATLFDALAKANINVRAIAQGCSEYNITVVL
KQEDCVRALRAAHSRFFLSKTTLAVGIIGPGLIGRTLLNQLKDQAAVLKENMNIDLRVMG
ITGSRTMVLSDTGIDLAHWKEQLQTEAEPANLDKFVDHLSENQLFPNRVLVDCTADTSVA
SHYYDWLKKGIHVITPNKKANSGPLDKYLKLRTLQRASYTHYFYEATVGAGLPIISTLRG
LLETGDKILRIEGIFSGTLSYIFNNFEGTRAFSDVVSEAKEAGYTEPDPRDDLSGTDVAR
KVIILARESGLKLELSDIPVRSLVPEALRISVMQSCSTADEYMQKLPSFDQDWARESKDA
EAAGEVLRYVGVVDLVNKEGQVELRRYKKDHPFAQLSGSDNIIAFTTSRYKEQPLIVRGP
GAGAEVTAGGVFSDILRLASYLGAPS
NT seq 2781 nt   +upstreamnt  +downstreamnt
atgtggagcctcgccgtcgcgagcccgcaccccgccgccgccttcgccgcggcccgtccc
cgccgcggccctcgccccgccgccgccccctcccacagaggtgtgaatccgcagcggtgg
cgatgtgagaagactcaggcatggtcgttttggagctctctgtgggccagcgaccttcca
ggaggactttatggggatgtttcgaagaatatgctcaagccagctgctgctgtttcagtt
gagcaagctgaagctagtgctcaccttccaaaaggtgacatgtggtctgtgcataaattt
ggtgggacctgcatgggaacctcccagaggattcagaatgtggctgacataatccttcgc
gacccttctgagaggaaactggtagttgtgtctgcaatgtctaaagtcactgacatgatg
tacaaccttgtaaataaggctcaatcaagggatgattcttatatcactgcacttgatgaa
gttttcgagaagcatatggcagcagcaaaggatctgcttggaggagaggaccttgcaaga
ttcttatctcagttgcacgcggatgtcagtaacctaaaagcaatgcttcgtgcaatttgc
atagctgggcatgccacggagtctttctcagattttgttgttggacatggagagatatgg
tcagctcaattgttgtcatttgccataaagaagtctggaaccccttgcagttggatggac
acacgagaagttttagttgtaaatcctacaggttccaaccaagtagatcctgactatttg
gaatctgagaaacgacttgagaaatggttcgctcgacagccagctgagacaataattgct
actgggtttattgcgagtacacctgaaaacattcctacaaccttgaaaagagatggaagt
gatttctctgcagccataattggttcacttgttaaggctggtcaggtcactatctggact
gatgttgatggggtctttagtgcagatcccagaaaagttagcgaggctgtcatattaagc
actttatcatatcaggaggcgtgggaaatgtcgtattttggggcaaatgtattacatccg
cgtaccatcatacctgtgatgaaatacaatatcccaattgttataagaaatatgttcaat
atttctgcccctggtaccatgatctgccagcagcctgcgaatgaaagtggtgatttggag
gcttgcgtcaaagcatttgcaactatagataaattgtctcttgttaacgttgaaggaact
ggaatggctggtgttcctggtactgcaagtgccatatttggtgctgtgaaggatgttgga
gctaatgttatcatgatatcgcaggctagtagtgaacactccgtatgctttgctgtacca
gaaaaggaagttgctgcagtttctgcagctttgcatgtcaggttccgtgaagcattatct
gcaggcaggctatctaaggtcgaagtcattcataattgtagcatccttgctgctgtcggc
ctgaagatggcaagtactcctggggtcagtgcaaccctttttgatgcacttgcaaaggca
aatattaatgtaagggcaatagctcaaggttgtagtgagtacaacatcactgttgtattg
aagcaagaggactgcgtaagggctcttagagctgctcactcaaggttcttcctctccaaa
accacacttgctgtcggaattattggacctgggttgattggtcgtactctccttaaccag
ctgaaggatcaggctgcagttcttaaggaaaatatgaacattgatctgcgtgtcatggga
atcactggttcgaggacaatggttttgagtgatacaggaatagatttggcccattggaaa
gagcagctacaaactgaagcagaaccagccaaccttgacaagtttgttgatcatttgtcc
gagaatcaattattccctaacagggttttggtggactgcacagcagacacaagtgttgca
tcccactattatgactggttaaagaagggaatccatgtcatcacgccaaataagaaagca
aattcagggccactggacaagtatttgaaacttaggactctacaacgtgcatcatatacc
cattacttctatgaagcaactgttggtgctggccttcctatcattagcactctgcgcggt
ctcctggaaacaggtgacaagatattgcgtattgaggggatcttcagtggaacattgagt
tacattttcaacaattttgaaggaacaagagctttcagtgatgttgtttctgaagcaaaa
gaggctggatacactgaacctgatccaagagatgatctgtctggaactgatgtagccaga
aaggtaataattcttgctagggaatctggattgaagcttgagctttctgatattcctgta
aggagtcttgtgccggaggcattgagaatttctgttatgcagtcctgttcaacagctgat
gaatacatgcaaaagttaccatcctttgaccaggactgggcaagagagagtaaagatgct
gaagctgccggagaagttttgcggtatgttggagtggtggatttggtgaacaaggagggt
caggtcgagctgcggaggtacaagaaggaccacccgttcgcgcagctatctggctccgac
aacatcatcgccttcacgacgtcaagatacaaggagcaaccgctgatcgtgcgaggcccg
ggcgccggtgcagaggtgaccgcaggaggtgtcttcagtgacatactacggctggcctcc
tacctaggcgctccctcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346642
Entry
4346642           CDS       T01015                                 
Name
(RefSeq) bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic
  KO
K12524  bifunctional aspartokinase / homoserine dehydrogenase 1 [EC:2.7.2.4 1.1.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00261  Monobactam biosynthesis
osa00270  Cysteine and methionine metabolism
osa00300  Lysine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
osa_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4346642
   00270 Cysteine and methionine metabolism
    4346642
   00300 Lysine biosynthesis
    4346642
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    4346642
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     4346642
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     4346642
SSDB
Motif
Pfam: Homoserine_dh AA_kinase NAD_binding_3 ACT_7 ACT
Other DBs
NCBI-GeneID: 4346642
NCBI-ProteinID: XP_015612302
UniProt: A0A0P0XLW2 Q69LG7
LinkDB
Position
9:complement(6995052..7009511)
AA seq 915 aa
MRSLAVASPLPPAAAVRRRPRASASGREVISQCWKCEINQDQPLGNSLRIGHSQGSLQRH
GSRNLLAAAAAISIEQAEVSTYLPKGDMWSVHKFGGTCMGTPQRIQNVADIVLGDSSERK
LIIVSAMSKVTDMMFNLVHKAQSRDNSYVTALDEVFNKHMAAAKELLDGEDLARFLAQLH
SDISNLRAMLRAIFIAGHATESFSDFVVGHGELWSAQMLSYAIKKSGVPCSWMDTREVLV
VKPSGSNQVDPDYLESEKRLQKWFSRQPAEIIIATGFIASTAENIPTTLKRDGSDFSASI
IGSLVRACQVTIWTDVDGVFSADPRKVSEAVILSTLSYQEAWEMSYFGANVLHPRTIIPV
MKDNIPIVIRNMFNLSAPGTTICKQPANENADLDACVKSFATIDKLALVNVEGTGMAGVP
GTASAIFSAAKDVGANVIMISQASSEHSVCFAVPEKEVAAVSTALHVRFREALAAGRLSK
VEVIRGCSILAAVGLRMASTPGVSAILFDALAKANINVRAIAQGCSEYNITVVLKQEDCV
RALRAVHSRFFLSKTTLAVGIIGPGLIGGTLLDQLKDQAAVLKENMNIDLRVIGISGSRT
MHLSDIGVDLNQWKELLRKEAEPADLDSFVRHLSENHVFPNKVLVDCTADTYVACHYYDW
LKKGIHVITPNKKANSGPLDRYLKLRTLQRASYTHYFYEATVGAGLPIISTLRGLLETGD
KILRIEGIFSGTLSYIFNNFEGTRTFSNVVAEAKEAGYTEPDPRDDLSGTDVARKVIILA
RESGLRLELSDIPVKSLVPEALRSCSSADEFMQKLPSFDQDWDRQRDEAEAAGEVLRYVG
VVDVANRKGRVELQRYKRDHPFAQLSGSDNIIAFTTSRYKEQPLIVRGPGAGAEVTAGGV
FCDILRLASYLGAPS
NT seq 2748 nt   +upstreamnt  +downstreamnt
atgcggagcctcgccgtcgcgagccccctcccgcccgccgccgcggttcgccgccggcca
cgcgcatccgcctccggaagggaagtgatttcacaatgttggaagtgtgagataaatcag
gaccaacctttggggaactccctaaggataggtcactcacaaggtagtttgcaaagacat
ggttccaggaatttgctcgcagctgctgcggctatttcaattgaacaagctgaagtcagt
acttatcttccaaaaggtgacatgtggtctgtgcacaagtttggtggcacctgtatggga
acaccccagagaattcagaatgttgctgatattgttcttggtgactcttctgagaggaag
ctgatcattgtttctgcaatgtccaaagtcactgacatgatgttcaaccttgtgcataaa
gctcagtcaagggataattcttatgtgactgcactggatgaagtttttaataagcatatg
gctgcagcaaaggaacttcttgatggagaagacctagcaagattcttggctcagttgcat
tctgacatcagtaacctgagagcgatgcttcgtgctatttttatagctggacatgcaaca
gaatcgttctctgatttcgttgttgggcatggagagttgtggtcagctcaaatgttgtcg
tatgctataaaaaagtctggggtgccttgcagttggatggatacaagagaagttctagta
gtgaaacctagtggttctaatcaggtcgatcctgactatttggaatctgagaagcgactc
cagaaatggttttcacgacaaccagcagagataataatcgctactgggtttattgccagt
acagccgaaaacattcctactacgcttaaaagggatggaagcgacttctcagcatcaata
attggatcccttgttagggcatgtcaggtcactatctggactgatgttgatggggtattt
agtgcagatcctagaaaagttagtgaggctgtgatcttaagcacattatcttatcaggag
gcctgggaaatgtcatattttggtgcaaatgttttgcatccccgcaccattatacctgtg
atgaaagacaatattcctattgtcattaggaatatgttcaatctatctgcccctggaaca
acaatttgcaagcagcctgctaatgaaaatgctgatttagatgcttgtgtcaaatcattt
gctactatagacaaattggcccttgttaatgtggaaggaactggaatggctggtgttcca
ggtacagcaagtgccatatttagtgctgccaaggatgttggagctaatgttatcatgata
tctcaggctagcagcgaacactcggtatgctttgctgttccagaaaaggaagttgcagca
gtctcgacagccttgcatgttaggtttcgtgaggcattagcagctggaaggctatctaag
gtcgaagtcattcgtgggtgcagcattcttgctgctgttggcttgaggatggccagtact
cctggagtcagtgcaatcctttttgatgcattagcaaaggcaaatattaatgtacgagca
atagcccaaggttgcagtgaatacaatattactgttgtgttgaagcaagaagattgtgtg
agggctttgagagctgttcattcaaggttcttcctctccaaaaccactcttgccgttggg
atcattggaccaggtttaattggtggaacacttcttgaccagctgaaagatcaggctgct
gttctcaaggaaaatatgaatattgatctacgtgttattggaatatctggctcaagaacg
atgcatttgagtgacataggggtagacttaaaccagtggaaagagcttctacgaaaagaa
gcagaaccagcagatcttgatagttttgttcgccatttgtctgaaaatcatgtatttcca
aacaaagttttggtggactgcacagcagatacatacgtagcatgccactattatgattgg
ttgaagaagggtatccatgtcatcacgccaaataagaaagcaaattctggtccgcttgat
cggtatctgaaattaaggactctgcagcgtgcatcgtatactcattacttttatgaagca
actgttggtgctggccttccaatcattagcaccctacgaggtcttctagagacaggtgac
aagatattgcgtattgagggcattttcagtgggactttgagttatattttcaacaatttt
gaaggtacacgaacttttagtaatgttgttgctgaagcaaaagaagctggatatacagag
ccagatccaagagatgatctatcaggaactgatgttgccagaaaggttattatccttgca
agggagtctggtctgaggctcgagctttccgatattcccgtaaagagccttgtgccagag
gcactgaggtcatgttcgtcagcagatgaattcatgcagaagctaccgtcctttgatcag
gactgggacaggcaacgcgatgaagctgaagctgcaggagaagtgctgcggtatgtgggc
gtggtggacgtggcgaacaggaagggccgggtagagctgcagaggtacaagagagaccac
cccttcgcgcagctgtccggctccgacaacatcatcgccttcaccacgtcgaggtacaag
gagcagccgctgatcgtgcgaggccccggcgccggcgcggaggtcaccgccggtggcgtc
ttctgcgacatcctgcggctggcgtcctacctgggagcaccctcctag

DBGET integrated database retrieval system