KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345663
Entry
4345663           CDS       T01015                                 
Name
(RefSeq) chlorophyll a-b binding protein P4, chloroplastic
  KO
K08910  light-harvesting complex I chlorophyll a/b binding protein 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00196  Photosynthesis - antenna proteins
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    4345663
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    4345663
Photosynthesis proteins [BR:osa00194]
 Antenna proteins
  Light-harvesting chlorophyll-protein complex (LHC) - Plant, Green alga [OT]
   LHCI
    4345663
SSDB
Motif
Pfam: Chloroa_b-bind
Other DBs
NCBI-GeneID: 4345663
NCBI-ProteinID: XP_015649730
UniProt: A3BTG2 Q6YWJ7
LinkDB
Position
8:complement(21171276..21172675)
AA seq 244 aa
MASVTARTPVAALRSSASLKSTFLGQSSTRLARAPTTRRNVRAEAKGEWLPGLPSPTYLN
GSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVLTKIGLIDAPQWY
DAGKATYFASSSTLFVIEFILFHYVEIRRWQDIKNPGCVNQDPIFKSYSLPPHECGYPGS
VFNPLNFEPTLEAKEKELANGRLAMLAFLGFLVQHNVTQKGPFDNLLQHLSDPWHNTIIQ
TLSG
NT seq 735 nt   +upstreamnt  +downstreamnt
atggcgtccgtcaccgcccgcaccccggtcgcagccctccgctcgtcggcgtcgctcaag
tctaccttcctagggcaatcctccacccgcctcgcccgcgcaccgactacgaggcgtaat
gttcgggcggaggccaagggagagtggctccccggcctcccttctcccacctacctcaac
ggcagcttgccaggcgataacgggttcgacccgttgggtctggcggaggacccggagaac
ctgcggtggttcgtgcaggcggagctggtgaacgggcggtgggcgatgctgggggtggcc
gggatgctgctgcctgaggtgctgacgaagatcgggttgatcgacgcgccgcagtggtac
gacgccggcaaggccacctacttcgcgtcgtcgtcgacgctgttcgtcatcgagttcatc
ctgttccactacgtggagatccggcggtggcaggacatcaagaaccctggctgcgtcaac
caggaccccatcttcaagagctacagcctcccgccgcacgagtgcggctaccccggcagc
gtcttcaaccccctcaacttcgagcccaccctcgaggccaaggagaaggagctcgccaac
gggaggctggcgatgctggcgttcttggggttcctggtgcagcacaacgtgacgcagaag
gggcccttcgacaacctgctgcagcacctgtctgacccgtggcacaacaccatcatccag
acgctgtcaggctga

DBGET integrated database retrieval system