KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346017
Entry
4346017           CDS       T01015                                 
Name
(RefSeq) 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3
  KO
K00021  hydroxymethylglutaryl-CoA reductase (NADPH) [EC:1.1.1.34]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4346017
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.34  hydroxymethylglutaryl-CoA reductase (NADPH)
     4346017
SSDB
Motif
Pfam: HMG-CoA_red
Other DBs
NCBI-GeneID: 4346017
NCBI-ProteinID: XP_015648250
UniProt: Q9XHL5
LinkDB
Position
8:25426641..25431500
AA seq 561 aa
MEVRRRAPLPPPPGRVQAGDALPLPIRHTNLIFSALFAASLAYLMRRWREKIRSSTPLHV
VGLAEMLAIFGLVASLIYLLSFFGIAFVQSIVSSSDDEEEDFLVGPARGSSAAAAVAPPP
PPSSPAQCSLLGSPHDDAARERMPEEDEEIVSSVVAGKVPSYVLETKLGDCRRAAGIRRE
AVRRITGRQIEGLPLDGFDYASILGQCCELPVGYVQLPVGIAGPLLLDGQRFYVPMATTE
GCLVASTNRGCKAIAESGGAVSVVLRDGMTRAPVARLPTARRAAELKAFLEDSVNFNTLS
MVFNRSSRFARLQGVQCAMAGRNLYMRFSCCTGDAMGMNMVSKGVQNVLDYLQDDFPDMD
VISISGNFCSDKKPAAVNWIEGRGKSVVCEAVIKEDVVKKVLKTNVQSLVELNVIKNLAG
SAVAGALGGFNAHASNIVTAIFIATGQDPAQNVESSHCITMLEAVNDGRDLHISVTMPSI
EVGTVGGGTQLASQAACLDLLGVKGANRESPGSNARLLATVVAGGVLAGELSLLSALAAG
QLVKSHMKYNRSSKDMSKVIS
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggaggtgcgccgcagggcgccgctgccgccgccgcccgggagggtgcaggcgggcgac
gcgctgccgctgccgatccggcacacgaacctgatattctcggcgctgttcgcggcgtcg
ctggcgtacctgatgcggcggtggcgggagaagatccggtcgtcgacgccgctccacgtg
gtggggctcgccgagatgctcgccatcttcggcctcgtcgcctcgctcatctacctcctc
agcttcttcggcatcgccttcgtgcagtccatcgtctcctccagcgacgacgaggaggag
gacttccttgtcgggcccgcccgtggctcctccgcggcggcggccgtcgcgccgccgccg
ccgccttcttctccggcgcagtgctcgctgctgggtagcccccacgacgatgccgcgcgg
gagagaatgccggaggaggacgaggagatcgtgtcgtcggtcgttgccgggaaggtcccc
tcctacgtgctggagaccaagctcggggattgccgccgcgcagccggaatccggcgcgag
gcggtccggcggatcaccgggaggcagatcgaggggctcccgctcgacggattcgactac
gcctcgatcctcgggcagtgctgcgagctcccagtggggtacgtgcagctccccgtcggc
atcgccgggccgctcctgctcgacggccagcggttctacgtccccatggccaccaccgag
gggtgcctcgtcgccagcacgaaccgcggctgcaaggccatcgccgagtccggcggcgcc
gtcagcgtcgtcctccgcgacgggatgacgcgcgcccccgtcgcccgcctccccaccgct
cgccgcgccgccgagctcaaggccttcttggaggattctgtcaacttcaataccctctcc
atggtcttcaataggtccagtagattcgcgaggctgcaaggggtacaatgtgccatggct
gggaggaacctgtacatgagattcagctgctgcacgggggatgccatggggatgaatatg
gtctccaagggcgtgcagaatgtgctggattacctccaagatgacttccctgacatggat
gttattagcatctcaggtaacttttgctctgacaagaagccagctgctgtgaattggatc
gaagggcgcggtaaatctgtggtttgtgaggcagtaatcaaggaggatgtagtcaaaaag
gtgctgaagaccaatgtgcaatcgttggtagagctcaacgtgatcaagaatcttgctggt
tcagctgttgctggggctcttgggggtttcaatgcccatgctagcaatattgtaactgca
atcttcatagccactgggcaggatcctgcccagaatgtggaaagctctcactgcatcaca
atgttggaagctgtaaatgatggcagagaccttcacatctccgttactatgccatcaatt
gaggtgggcacagttgggggagggactcagctggcgtcacaggctgcttgcttggacctg
ctcggcgtgaaaggcgcgaacagggaatccccgggatcaaacgcgaggctcctggccacc
gtggtggcaggtggtgtccttgccggggagctgtccctcctatctgcactcgccgcaggc
cagcttgtcaagagccacatgaaatacaacaggtccagcaaagacatgtccaaggtgatt
tcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347443
Entry
4347443           CDS       T01015                                 
Name
(RefSeq) 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3-like
  KO
K00021  hydroxymethylglutaryl-CoA reductase (NADPH) [EC:1.1.1.34]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4347443
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.34  hydroxymethylglutaryl-CoA reductase (NADPH)
     4347443
SSDB
Motif
Pfam: HMG-CoA_red
Other DBs
NCBI-GeneID: 4347443
NCBI-ProteinID: XP_015612324
UniProt: A0A0P0XNV2 Q0J0M8
LinkDB
Position
9:19074059..19078693
AA seq 576 aa
MAVEGRRRVPLPLPPPTRRGKQQQQQGGERARRVQAGDALPLPIRHTNLIFSALFAASLA
YLMRRWREKIRTSTPLHVVGLAEILAICGLVASLIYLLSFFGIAFVQSVVSNSDDEEEEE
DFLIDSRAAGPVAAQATPPPAPAPFSLLGSACAAPKKMPEEDEEIVAEVVAGKIPSYVLE
TRLGDCRRAAGIRREALRRTTGREIRGLPLDGFDYASILGQCCELPVGYVQLPVGVAGPL
VLDGERFYVPMATTEGCLVASTNRGCKAIAESGGATSVVLQDGMTRAPVARFPSARRAAE
LKGFLENPANFDTLAMVFNRSSRFARLQRVKCAVAGRNLYMRFSCSTGDAMGMNMVSKGV
QNVLDYLQDDFPDMDVISISGNFCSDKKSAAVNWIEGRGKSVVCEAVIKEEVVKKVLKTN
VQSLVELNVIKNLAGSAVAGALGGFNAHASNIVTAIFIATGQDPAQNVESSQCITMLEAV
NDGKDLHISVTMPSIEVGTVGGGTQLASQSACLDLLGVKGANRESPGSNARLLAAVVAGA
VLAGELSLISAQAAGHLVQSHMKYNRSSKDMSKVAS
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggctgtggagggccgccgccgcgtgccgctgccgctgccgccgccgacgaggcggggg
aagcagcagcagcagcaggggggggagagggcgaggagggtgcaggccggggacgcgctc
ccgctgccgatccggcacacgaacctcatcttctcggcgctgttcgcggcgtcgctggcc
tacctgatgcggcggtggcgggagaagatccgcacgtcgacgccgctccacgtggtgggg
ctcgccgagatcctcgccatctgcggcctcgtcgcctcgctcatctacctcctcagcttc
ttcggcatcgcgttcgtgcagtccgtcgtctccaacagcgacgatgaggaggaggaggag
gacttcctgatcgactcccgcgccgcgggccccgtcgccgcgcaggctacccctccgccg
gcgccggcgccgttctcgctgctggggagcgcctgcgccgccccgaagaaaatgccggag
gaggacgaggaaatcgtggccgaggtcgtggcggggaagatcccgtcgtacgtgctggag
accaggctgggcgactgccgccgcgccgccgggatccggcgcgaggcgctgcggcggacc
acggggagggagatcaggggcctccccctcgacggcttcgactacgcctccatcctcggc
cagtgctgcgagctccccgtgggctacgtgcagctgccggtgggcgtcgccggcccgctc
gtgctcgacggcgagcggttctacgtcccgatggccaccaccgagggctgcctcgtcgcc
agcacgaaccgcgggtgcaaggccatcgccgagtctggcggtgccaccagcgtcgtgctc
caggacgggatgacgcgcgcccccgtcgcccgcttcccctccgcgcgccgcgccgccgag
ctcaagggcttcttggagaacccggccaacttcgatactcttgccatggtcttcaataga
tcgagcagattcgctaggctgcagagagtgaagtgcgcggtggccgggaggaacctctac
atgcggttcagctgcagcacaggggatgccatggggatgaacatggtgtccaagggcgtc
cagaacgtgctggactaccttcaggatgacttccctgacatggatgtcatcagcatatca
ggtaacttctgttctgacaaaaagtcagctgctgtaaattggattgagggacgtggaaag
tctgtggtttgtgaggcagtaatcaaagaggaagttgtgaaaaaggttctcaagaccaac
gttcagtcactagtagaattgaacgtcatcaagaaccttgctggttcagctgttgctgga
gctttgggtggcttcaatgcccatgctagcaacattgtaacagccatctttattgccacc
ggtcaggatcctgcacagaatgtggaaagctcccagtgcatcacaatgttggaagctgta
aatgatggcaaagatcttcatatctctgttactatgccatcaattgaggtgggcacggtt
ggtggaggcacacagctggcctcacagtctgcttgcttggacctacttggcgtgaagggc
gcaaacagggaatccccaggatcaaatgcgaggctcctggccgccgttgtggctggcgct
gtccttgctggggagttgtccctcatctctgctcaagctgcaggccatttggtccagagc
cacatgaaatacaacagatccagcaaagatatgtccaaggtcgcctcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272427
Entry
9272427           CDS       T01015                                 
Name
(RefSeq) 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1
  KO
K00021  hydroxymethylglutaryl-CoA reductase (NADPH) [EC:1.1.1.34]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    9272427
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.34  hydroxymethylglutaryl-CoA reductase (NADPH)
     9272427
SSDB
Motif
Pfam: HMG-CoA_red
Other DBs
NCBI-GeneID: 9272427
NCBI-ProteinID: XP_015623837
UniProt: Q0DY59
LinkDB
Position
2:complement(29586987..29592185)
AA seq 532 aa
MDVRRGGGGGRIVGAARRALTWGALPLPMRITNGLAMVSLVLSSCDLLRLCSDRERPLGG
REFATVVYLVSLFAHPDAPATTTGDDDDGQGGSRRARPAAAEPAPMHGHGGGMMEADDEE
IVAAVASGALPSHRLESRLGDCRRAARLRREALRRVTGRGVEGLPFDGMDYQAILGQCCE
MPVGYVQLPVGVAGPLLLDGREYHVPMATTEGCLVASVNRGCRAISASGGAFSVLLRDAM
SRAPAVKLPSAMRAAELKAFAEAPANFELLAAVFNRSSRFGRLQDIRCALAGRNLYMRFS
CITGDAMGMNMVSKGVENVLGYLQNVFPDMDVISVSGNYCSDKKPTAVNWIEGRGKSVVC
EAIIKGDVVQKVLKTTVEKLVELNIIKNLAGSAVAGALGGFNAHASNIVTALFIATGQDP
AQNVESSQCITMLEEVNDGDDLHISVTMPSIEVGTIGGGTCLASQAACLNLLGVKGSNHG
SPGANAKRLATIVAGSVLAGELSLLAALASGHLVKSHMMYNRSSKDVAKAAS
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggacgtgcgccggggcgggggcggagggcgcatcgtcggggcggcgcggagggcgctc
acctggggggcgctgcccctcccgatgcggatcaccaacggcctggccatggtctccctc
gtgctctcctcctgcgacctgctccgcctctgcagcgacagggagcggcccctcggcggc
cgggagttcgccaccgtcgtctacctcgtcagcctcttcgcccaccctgacgcccccgcc
accaccaccggcgacgacgacgacggccaggggggctcccgccgcgcgcgccccgccgcc
gcggagcccgcgccaatgcatgggcatggtggcgggatgatggaggccgacgacgaggag
atcgtcgccgcggtggcgtccggcgcgctgccgtcgcaccgcctggagtcgcggctcggg
gactgccgccgcgcggcgaggctgaggcgggaggcgctgcggcgggtgacggggcgggga
gtggagggcctccccttcgatgggatggactaccaggccatcctggggcaatgctgcgag
atgcccgtcgggtacgtgcagctccccgtgggggtcgccggcccgctgctcctggacggc
cgcgagtaccatgtccccatggctaccaccgagggatgcctcgtcgccagcgtcaaccgc
gggtgcagggccatctccgcttccggcggcgccttcagcgttctgctccgggacgccatg
tcccgcgctcctgctgtcaagctgccttccgcaatgcgggcagcggagctcaaggcgttt
gctgaggcgcctgcgaattttgagttgctggctgctgtcttcaataggtccagcagattt
ggtaggcttcaagacattcgttgtgcactcgctgggaggaacctatatatgagatttagc
tgtatcactggagatgctatgggaatgaacatggtgtcaaaaggtgttgagaatgtcttg
ggctatctgcagaatgtcttccctgacatggatgtcatcagcgtatctggtaactattgc
tcagacaagaagccgacagctgtaaactggatagaaggccgggggaaatctgttgtttgt
gaggctattattaaaggagatgttgtgcagaaagttcttaagacgactgtagaaaaactt
gttgagcttaacattatcaaaaatcttgctggatcagctgtagctggggctcttgggggt
tttaatgcccatgcgagtaatattgttactgcattattcattgctacaggacaggatcct
gcacaaaatgttgaaagctcacaatgcatcaccatgttggaagaagtaaatgatggagat
gatcttcatatctctgtcaccatgccgtccattgaggtaggtacaatcggaggtggtaca
tgtctggcctcacaggcggcttgtttgaacctgcttggtgtcaagggttcaaatcatggc
tcacctggtgcaaatgctaaacgtttggctaccatagtagctggcagcgtgctcgctggc
gagctctcgctccttgccgctcttgcctctggtcaccttgtcaagagccacatgatgtac
aatcgatcaagtaaggatgtcgccaaggctgcttcttga

DBGET integrated database retrieval system