KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346082
Entry
4346082           CDS       T01015                                 
Name
(RefSeq) signal recognition particle receptor subunit beta
  KO
K12272  signal recognition particle receptor subunit beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4346082
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4346082
   04031 GTP-binding proteins [BR:osa04031]
    4346082
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4346082
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Unclassified
   4346082
SSDB
Motif
Pfam: SRPRB Arf GTP_EFTU Gtr1_RagA ATP_bind_1 Roc MMR_HSR1 Ras FeoB_N cobW AAA_16 RsgA_GTPase KH_dom-like TsaE NACHT DAP3 AAA_30 ABC_tran Parvo_NS1 AAA_22
Other DBs
NCBI-GeneID: 4346082
NCBI-ProteinID: XP_015650550
UniProt: Q6ZK21 A3BV00
LinkDB
Position
8:complement(26046719..26049677)
AA seq 256 aa
MDEWVRQAEVWVGQAERWIRQQPPEQVYVAVAVVAVTVLLLVAVSCLKSSKANTIVLSGL
SGSGKTILFYQLRDGSTHQGTVTSMEQNNDTFVLHSELERRGKVKPVHVVDVPGHARLKP
KLDEVLPQAAGIVYVVDAQDFLSTMHAAAEYLYDILTKATVVKKRVPVLIFCNKTDKVTA
HSKEFIKKQLEKELNKLRESRNAISSADITDEVKLGNPGEAFNFSQCQNKVTVTEGAGLT
GNVSAVEEFIREYVKA
NT seq 771 nt   +upstreamnt  +downstreamnt
atggacgagtgggttcgccaggccgaggtgtgggtgggacaagccgagaggtggatccgg
cagcagcctcccgagcaggtttacgtcgccgtcgcggtggtcgccgtgacggttctgttg
ctggtcgcagtttcgtgcctgaaatcctcgaaagcaaacaccatagtgctatctgggctc
agtggtagtggcaaaactattctcttctaccagcttcgggatggatcaacacatcaagga
actgtgacttcaatggaacaaaacaacgatactttcgtgcttcattctgagctggagagg
agaggcaaagtaaaacctgttcatgttgttgacgttcctggtcatgcaaggctcaaaccc
aaacttgatgaagtcctgcctcaagcagctggaatagtttatgttgttgatgctcaagat
ttcttgtctaccatgcatgctgctgcagagtacttgtatgacatcctgacaaaggcaact
gtagtgaagaagagggttcctgttctgatattctgcaacaagacagataaagttacagct
cactcaaaagaattcatcaagaagcaattggaaaaggaattaaacaagctccgggaatca
aggaacgccatatcatctgctgacatcactgatgaagtcaagcttgggaaccctggagaa
gcatttaatttcagccaatgccagaacaaggtgacagttactgaaggtgctggtctgacc
ggtaatgtttcagcggttgaggagttcattcgtgagtatgtgaaagcttag

DBGET integrated database retrieval system