KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346086
Entry
4346086           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L32-1
  KO
K02912  large subunit ribosomal protein L32e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4346086
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4346086
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4346086
  Archaea
    4346086
SSDB
Motif
Pfam: Ribosomal_L32e
Other DBs
NCBI-GeneID: 4346086
NCBI-ProteinID: XP_015650645
UniProt: Q84QW3
LinkDB
Position
8:26090840..26092935
AA seq 133 aa
MAVPLLTKKIVKKRVKQFKRPHSDRYLCLKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGS
DKKTRHYLPNKFKKFVVHNVSELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDIVV
TNKLARLRSQEDE
NT seq 402 nt   +upstreamnt  +downstreamnt
atggcggtgccgctgctgacgaagaagatcgtgaagaagagggtcaagcagttcaagagg
ccccatagtgaccgctacctatgcctcaagccaagctggcgcaggcccaagggtattgac
tcccgtgtcaggagaaagttcaagggatgcaccttgatgcccaacattggttacggctca
gacaagaagaccaggcactacctccccaacaagttcaagaagtttgtggtgcacaatgtc
tctgagctggagttgctcatgatgcacaacaggacctactgtgccgagattgcccacaac
gtctctacgaagaagcgcaaggagatcgttgagcgtgctgcgcagctcgacatcgtggtc
accaacaagcttgcaaggctccgtagccaggaggacgagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347487
Entry
4347487           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L32-1
  KO
K02912  large subunit ribosomal protein L32e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4347487
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4347487
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4347487
  Archaea
    4347487
SSDB
Motif
Pfam: Ribosomal_L32e
Other DBs
NCBI-GeneID: 4347487
NCBI-ProteinID: XP_015610703
UniProt: B9G4E8 A0A8J8YKI4
LinkDB
Position
9:complement(19413175..19414860)
AA seq 170 aa
MDSTILGFLDIRKPSLLPNSSTPPPPPPPRRCSDRSKMAVPLLTKKIVKKRVKQFKRPHS
DRYIGLKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSEL
ELLMMHNRMYCAEIAHNVSTKKRKEIVERAAQLDIVVTNKLARLRSQEDE
NT seq 513 nt   +upstreamnt  +downstreamnt
atggactccaccattctagggttcctggatataagaaaaccttctctcctcccgaactcc
tccacgccgccgccgccgccgccacctcgccgctgctccgaccggtcgaagatggcggtt
ccattgctgacgaagaagatcgtgaagaagcgggtgaagcagttcaagaggccgcacagc
gaccgctacattggcctcaagacaagctggcgcagaccaaagggtattgactcacgtgtc
aggaggaagttcaagggatgcacattgatgcccaatattggatatggttcggacaagaag
accaggcattacctgcccaacaagttcaagaagtttgtggtgcacaacgtctcagagctg
gagctgcttatgatgcacaacaggatgtactgtgctgaaattgctcataatgtgtccacg
aagaaacgcaaggagatagtggagcgcgctgctcagcttgacattgtcgtcaccaacaag
cttgccaggctacgcagccaggaggatgagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347488
Entry
4347488           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L32-1
  KO
K02912  large subunit ribosomal protein L32e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4347488
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4347488
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4347488
  Archaea
    4347488
SSDB
Motif
Pfam: Ribosomal_L32e
Other DBs
NCBI-GeneID: 4347488
NCBI-ProteinID: XP_015651355
UniProt: Q0J0Q8 A3C0C7
LinkDB
Position
9:complement(19418964..19421187)
AA seq 133 aa
MAVPLLTKKIVKKRVKQFKRPHSDRYIGLKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGS
DKKTRHYLPNKFKKFVVHNVSELELLMMHNRTYCAEIAHNVSTKKRKEIVERAAQLDIVV
TNKLARLRSQEDE
NT seq 402 nt   +upstreamnt  +downstreamnt
atggcggtgccgttgctgacgaagaagatcgtgaagaagcgggtgaagcagttcaagagg
ccgcacagcgaccgctacatcggcctcaagacaagctggcgcaggccaaagggtatcgac
tcccgtgtcaggagaaagttcaagggatgcactttgatgcctaatattggctatggttct
gacaagaagacgaggcattaccttcccaacaaattcaagaagtttgtcgtccacaatgtc
tctgagctggagttacttatgatgcacaacaggacatactgtgctgagatcgctcacaat
gtctcaacgaagaagcgcaaggagatcgtggagcgtgctgcacagcttgatatcgtggtc
accaacaagcttgccaggcttcgcagccaggaggacgagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268508
Entry
9268508           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L32-1
  KO
K02912  large subunit ribosomal protein L32e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9268508
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9268508
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    9268508
  Archaea
    9268508
SSDB
Motif
Pfam: Ribosomal_L32e
Other DBs
NCBI-GeneID: 9268508
NCBI-ProteinID: XP_015651415
UniProt: B7E905 C7J6X4
LinkDB
Position
9:19398850..19401021
AA seq 133 aa
MVVPLLTKKIVKKRVKQFKRPHSDRYIGLKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGS
DKKTRHYLPNKFKKFVVHNVSELELLMMHNRTYCAEIAHNVSTRKRKEIVERAAQLDIVV
TNKLARLRSQEDE
NT seq 402 nt   +upstreamnt  +downstreamnt
atggtggtgccgttgctgacgaagaagatcgtgaagaagcgggtgaagcagttcaagagg
ccgcacagcgaccgctacattggcctcaagacaagctggcgcaggccaaagggtattgac
tctcgtgtcaggagaaagttcaaaggatgcaccttgatgcccaacattggatatggttct
gacaagaagacaaggcactaccttcccaacaagttcaagaagtttgtggtgcacaatgtc
tctgagctggagctgcttatgatgcacaacaggacatactgcgctgagattgctcacaac
gtctccacccgcaagcgcaaggagatcgtcgagcgcgctgcgcagctggacatcgtggtc
accaacaagcttgccaggctccgcagccaggaggacgagtga

DBGET integrated database retrieval system