KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346117
Entry
4346117           CDS       T01015                                 
Name
(RefSeq) proteasome subunit beta type-1-like
  KO
K02732  20S proteasome subunit beta 6 [EC:3.4.25.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4346117
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4346117
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4346117
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     4346117
Peptidases and inhibitors [BR:osa01002]
 Threonine peptidases
  Family T1: proteasome family
   4346117
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    4346117
SSDB
Motif
Pfam: Proteasome PT-TG
Other DBs
NCBI-GeneID: 4346117
NCBI-ProteinID: XP_015648939
UniProt: B9G1X5 Q6ZIB4
LinkDB
Position
8:26342339..26344528
AA seq 219 aa
MARFEVYENNGGTCVAVAGADYCVVAADTRLSVGYSILSRDSSKIAHLADKCVLASSGFQ
GDVKALQRNLTAKELLYEHNHNKKMSCPAMAQLLSNTLYYKRFFPYYAFNVLGGLDSEGK
GCVFTYDAVGSYERTGYSAQGTGAALMMPVLDNQLKSPSPLLLPARDAVTPLSQSDAVDL
VKDVFASATERDIYTGDKLEIVVINSAGSHREFIELRKD
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcgaggttcgaggtgtacgagaacaacggcggcacgtgcgtggccgtcgccggcgcc
gactactgcgtggtcgccgccgacacgcgcctctccgtcggatacagcatcctcagccgc
gacagctccaagatcgcccacctagcggataaatgtgttttggcctcatctggatttcaa
ggtgatgttaaagctttgcagaggaaccttactgccaaggaattgctttatgaacacaac
cataacaagaaaatgagctgccctgcgatggcgcaattactgtccaacacgctctactac
aaaaggttcttcccatactatgccttcaatgtgttgggtggacttgacagcgaaggtaaa
ggatgtgtcttcacatatgatgctgttgggtcttatgaaaggacaggttatagtgctcag
gggacaggtgcagctttgatgatgcctgttctggacaatcagctaaaatctcctagccca
ttactacttccagctcgggatgcagtgacaccattatctcaatcagatgctgtcgatctg
gttaaggacgtttttgcatcagccacagaacgagacatatacactggagataaactggag
attgttgtcatcaacagcgccggctctcaccgtgagttcattgagctaaggaaggattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347507
Entry
4347507           CDS       T01015                                 
Name
(RefSeq) proteasome subunit beta type-1
  KO
K02732  20S proteasome subunit beta 6 [EC:3.4.25.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4347507
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4347507
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4347507
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     4347507
Peptidases and inhibitors [BR:osa01002]
 Threonine peptidases
  Family T1: proteasome family
   4347507
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    4347507
SSDB
Motif
Pfam: Proteasome PT-TG
Other DBs
NCBI-GeneID: 4347507
NCBI-ProteinID: XP_015611664
UniProt: O64464 A0A516UX48
LinkDB
Position
9:19562259..19565710
AA seq 221 aa
MSRRGDWVYENNGGTCVAIAGADYCVVAADTRLSVGYNILTRDHSKICELADKCALASSG
FQGDIKALHKNLAARELLYQHQHNKRMSCPAMAQLLSNTLYYKRFFPYYAFNVLGGLDSE
GKGCVFTYDAVGSYERTGYSAQGTGSALIMPVLDNQLKSPSPLLLPARDAVTPLSETEAV
DLVKDVFASATERDIYTGDKLEIVVINKAGTKREYIDLRKD
NT seq 666 nt   +upstreamnt  +downstreamnt
atgtcgaggcgcggcgactgggtctacgagaacaacggcgggacgtgcgtggccatcgcc
ggcgcggactactgcgtggtggccgccgatacccgcctttccgtcggatacaacatcctc
acgcgcgaccactccaagatctgcgagctagcggacaaatgcgcactagcatcttccggc
ttccaaggtgatatcaaagctctgcacaagaacttggctgccagagaattgctgtaccag
caccagcacaataaaaggatgagctgccctgccatggcacaactgctctccaacactctg
tactacaagcgattcttcccatattatgctttcaatgtacttggtgggcttgatagtgaa
gggaaaggatgtgttttcacctatgatgcagttgggtcctatgagaggactggctacagt
gcacagggaacaggatctgctttgatcatgccagtgctggacaaccaactaaaatcacct
agtccactattactccctgcaagagatgccgtcacacctttgtcggagacagaggcggtc
gatttagtgaaggatgtgtttgcatcggcaactgagagggacatctacactggtgataag
ctggagatagttgtcatcaacaaagctgggacgaagcgagagtacatcgacctgaggaag
gactag

DBGET integrated database retrieval system