KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346123
Entry
4346123           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L17
  KO
K02880  large subunit ribosomal protein L17e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4346123
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4346123
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4346123
SSDB
Motif
Pfam: Ribosomal_L22
Other DBs
NCBI-GeneID: 4346123
NCBI-ProteinID: XP_015648317
UniProt: Q6ZIA1 Q6ZJ74
LinkDB
Position
8:complement(26406009..26408546)
AA seq 171 aa
MGKYSTEPSNPTKSAKAMGRDLRVHFKNTRETAFALRKLPLVKAKRYLEDVIAHKQAIPF
RRYCGGVGRTAQVKSRQSNGQGRWPAKSARFILDLLKNAESNADVKGLDVDNLFVSHIQV
NQAQKQRRRTYRAHGRINPYMSSPCHVELILSEKEEAVKKEPETTIAPRRQ
NT seq 516 nt   +upstreamnt  +downstreamnt
atgggcaagtactcgacggagccgtccaacccgaccaagtcggccaaggccatggggagg
gatctcagggtccacttcaagaacacaagggagacagcgttcgctcttcgcaagctgcct
ttggtcaaggcaaagcggtaccttgaggatgttattgctcacaagcaggcaattcccttc
agaaggtactgtggaggcgtgggccgtactgcacaagtgaagtctcgccaatcaaatggg
cagggcaggtggcctgccaaatcagccaggttcattttggatctgctgaagaatgctgag
agtaacgctgatgttaaaggcttggatgtcgacaacctcttcgtttcacacatccaggtg
aaccaagcccagaagcagagacgccggacataccgtgctcatggacgcatcaatccttac
atgtcctcaccctgccacgtcgagcttatcttgtcagagaaggaagaggccgtgaagaaa
gagcctgaaaccaccatcgccccgaggaggcagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346540
Entry
4346540           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L17
  KO
K02880  large subunit ribosomal protein L17e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4346540
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4346540
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4346540
SSDB
Motif
Pfam: Ribosomal_L22
Other DBs
NCBI-GeneID: 4346540
NCBI-ProteinID: XP_015612256
UniProt: A3BWK9 Q6K1W6
LinkDB
Position
9:complement(4390972..4393909)
AA seq 171 aa
MVKYSREANNPTKSSKAMGRDLRVHFKNTRETAFAIRKLPLGKAKRYLEDVIAHKQAIPF
RRYCGGVGRTAQAKSRHSNGQGRWPAKSARFILDLLKNAESNAEVKGLDVDTLYVSHIQV
NQAQKQRRRTYRAHGRINPYMSSPCHIELILSEKEEPVKKEPESQIAARKA
NT seq 516 nt   +upstreamnt  +downstreamnt
atggtgaagtactcgagggaggcgaacaaccccaccaagtcctccaaggccatgggccgg
gacttgcgtgtgcacttcaagaacacccgtgagacagcttttgctatcaggaagttgcct
ctgggcaaggccaagaggtaccttgaggatgtgattgcccacaagcaagctatccccttc
cgtaggtactgcggtggtgttggccgcactgctcaagctaagtcacgccattcaaacggt
cagggacgctggcctgccaagtctgctagattcattctggatcttcttaagaatgcagag
agcaatgctgaggtgaaaggtctggatgttgatactctttatgtgtcccacattcaagtt
aaccaggcccagaagcagaggcgccgtacctaccgtgctcatggacgcatcaacccttac
atgtcctccccgtgccacattgagcttatcctgtcagagaaggaagaaccagtgaagaaa
gagcctgagtctcagatcgcagccaggaaggcctag

DBGET integrated database retrieval system