KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346173
Entry
4346173           CDS       T01015                                 
Name
(RefSeq) chitin elicitor receptor kinase 1-like isoform X2
  KO
K13429  chitin elicitor receptor kinase 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4346173
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4346173
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  Other
   4346173
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase EphA2_TM Adeno_E3_CR2
Other DBs
NCBI-GeneID: 4346173
NCBI-ProteinID: XP_015650771
UniProt: A0A0P0XII1
LinkDB
Position
8:26908888..26913497
AA seq 624 aa
MEASTSLLVLVLAAAAFAAGTVTEAAGDGCSAGCDLALASFYVTPNQNVTNMADLFGIGA
ANYRSLAPYNPNIPNLDFINVGGRVNVYFTCGCRSLPGSPGATYLAGAFPFQMSRGQIYT
SVAANYNNLTTAEWLQATNSYPANNIPDTAVINATVNCSCGDASISPDYGLFLTYPLRAE
DTLASVAATYGLSSQLDVVRRYNPGMESATGSGIVYIPVKDPNGSYLPLKSPGKGASAGA
IAGGVVAGVVVLAAIFLYIIFYRRRKAKQATLLQSSEDSTQLGTISMDKVTPSTIVGPSP
VAGITVDKSVEFSYEELSNATQGFSIGNKIGQGGFGAVYYAELRGEKAAIKKMDMQATHE
FLAELKVLTHVHHLNLVRLIGYCIESSLFLVYEFIENGNLSQHLRGMGYEPLSWAARIQI
ALDSARGLEYIHEHTVPVYIHRDIKSANILIDKNYRAKVADFGLTKLTEVGGTSMPTGTR
VVGTFGYMPPEYARYGDVSPKVDVYAFGVVLYELISAKEAIVRSTESSSDSKGLVYLFEE
ALNSPDPKEGLRTLIDPKLGEDYPIDSILKLTQLAKVCTQEDPKLRPSMRSVVVALMTLS
STSEFWDMNNLYENQGLVNLMSGR
NT seq 1875 nt   +upstreamnt  +downstreamnt
atggaagcttccacctccctcctagtcctcgtcctcgccgccgcggcgttcgcggcgggg
acggtgacggaggcggcgggggacgggtgcagcgccgggtgcgacctcgcgctggcttcc
ttctacgtgacgccgaaccagaacgtcaccaacatggcggatctcttcggcatcggcgcg
gcgaactaccgcagcctcgcgccctacaacccgaacatccccaacctcgacttcatcaac
gtcggcggccgcgtcaacgtctacttcacctgcggctgccgctcgctgccgggctcgccg
ggagccacctacctcgccggcgccttccccttccagatgtcccgcggccagatctacacc
tccgtcgccgccaactacaacaacctcaccaccgccgagtggctgcaggccaccaacagc
tacccggccaacaacatcccggacaccgccgtcatcaacgccaccgtcaactgctcctgc
ggcgacgccagcatctcgccggactacgggctgttcctcacctacccgctccgcgccgag
gatacgctcgcctccgtcgcggcgacctacgggctctcgtcgcagctggacgtggtcagg
aggtacaacccggggatggagagcgccacggggagtggaatcgtgtacatccccgtcaaa
gatcccaatggaagttacctacctctgaaatcaccaggaaagggagcttctgcaggagct
atagcaggaggtgttgtggctggtgtcgttgtgcttgctgccatcttcttgtatatcata
ttctataggaggagaaaggcaaaacaggccaccctgcttcaatcatctgaagattccaca
caacttggtacgatatccatggataaagttaccccatcaacaattgttggcccttcacca
gttgcaggcattacagttgacaaatcagtagagttctcatatgaagaactttctaatgct
acacaggggtttagtattggcaataaaatagggcaaggtggttttggtgctgtctattat
gctgaacttagaggcgagaaagctgccatcaagaaaatggacatgcaggctactcatgag
ttccttgctgaattaaaggttttgacacatgttcatcatctgaacctggtgcgtttgatt
ggttattgcatcgagagctctttgttccttgtctatgaatttatcgagaatggcaacttg
agccagcatttgcgtggaatgggttatgaacctttgtcttgggctgccaggattcaaatt
gcactagattcagcaagaggtcttgaatacattcatgaacatactgttccagtatacata
catcgggacatcaaatcagcaaacatcttgatagacaagaactaccgggcaaaggttgca
gattttggtttaacaaagcttacagaagttggtggtacatcaatgcccacaggcacacgt
gttgttggtacatttggttacatgcctccagagtatgctcgatatggagatgtttctcct
aaggttgacgtctacgcctttggtgttgtcctctacgaacttatttcagcgaaagaagcc
atagtcagatcaaccgaatcttcaagtgattcaaaggggctggtttatctgtttgaggag
gccctcaactcgccggatcccaaggaaggccttaggacgttgattgatccaaagctagga
gaagattatcctattgattccattctcaagctgacacaactcgcaaaggtgtgcacacaa
gaagaccccaagctgaggccttcaatgagatccgtggtcgtcgcgctgatgacgctttca
tccacaagtgagttctgggacatgaacaacctgtatgagaaccaaggtttggtcaaccta
atgtccgggagatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270778
Entry
9270778           CDS       T01015                                 
Name
(RefSeq) chitin elicitor receptor kinase 1 isoform X2
  KO
K13429  chitin elicitor receptor kinase 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    9270778
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    9270778
Protein kinases [BR:osa01001]
 Serine/threonine kinases: Other
  Other
   9270778
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH Kinase-like Pkinase_fungal PspB
Other DBs
NCBI-GeneID: 9270778
NCBI-ProteinID: XP_015611968
UniProt: D7UPN3
LinkDB
Position
9:19861217..19866333
AA seq 605 aa
MFSLPALLIGACAFAAAAVAASGDGCRAGCSLAIAAYYFSEGSNLTFIATIFAIGGGGYQ
ALLPYNPAITNPDYVVTGDRVLVPFPCSCLGLPAAPASTFLAGAIPYPLPLPRGGGDTYD
AVAANYADLTTAAWLEATNAYPPGRIPGGDGRVNVTINCSCGDERVSPRYGLFLTYPLWD
GETLESVAAQYGFSSPAEMELIRRYNPGMGGVSGKGIVFIPVKDPNGSYHPLKSGGMGNS
LSGGAIAGIVIACIAIFIVAIWLIIMFYRWQKFRKATSRPSPEETSHLDDASQAEGIKVE
RSIEFSYEEIFNATQGFSMEHKIGQGGFGSVYYAELRGEKTAIKKMGMQATQEFLAELKV
LTHVHHLNLVRLIGYCVENCLFLVYEFIDNGNLSQHLQRTGYAPLSWATRVQIALDSARG
LEYLHEHVVPVYVHRDIKSANILLDKDFRAKIADFGLAKLTEVGSMSQSLSTRVAGTFGY
MPPEARYGEVSPKVDVYAFGVVLYELLSAKQAIVRSSESVSESKGLVFLFEEALSAPNPT
EALDELIDPSLQGDYPVDSALKIASLAKSCTHEEPGMRPTMRSVVVALMALTANTDLRDM
DYHPF
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgttctctctccccgccctcctcatcggcgcctgtgccttcgcggcggcggcggttgcg
gcgtccggcgacggttgccgcgccggctgctcgctggccatcgccgcctactacttctcc
gagggttcaaacctcaccttcatcgccaccatcttcgccatcggcggcggcggctaccaa
gcgctgctcccctacaacccggccatcaccaacccggactacgtcgtcaccggcgaccgc
gtgctcgttcccttcccctgctcctgcctcgggctccccgccgcgcccgcctccaccttc
ctcgcaggcgccatcccctacccgctccccctcccccgcggcggcggcgacacctacgac
gccgtcgccgccaactacgccgacctcaccaccgccgcgtggctggaggccaccaacgcg
tacccgccggggaggatccccggcggcgatgggagggtcaacgtcaccatcaactgctca
tgcggcgacgagagggtctcgccgcggtacgggctgttcctcacctacccgctctgggac
ggggagacgctcgaatcggtggccgcgcagtacgggttctcgtcgccggcggagatggag
ctgatcaggaggtacaaccccgggatgggaggggtctccgggaaggggattgtgttcatc
ccggtgaaagatccaaatggaagttaccaccctctgaaatcaggtggaatggggaatagc
ctttctggaggagcgatagcaggaattgtgatagcttgcattgctattttcattgtggcc
atatggttgattatcatgttctataggtggcaaaagttcaggaaggccacatcgcgtcca
tctccagaagaaaccagccaccttgatgatgcttcccaagctgaaggcattaaggttgag
agatccatagaattctcatatgaagagatttttaatgcaacacagggattttctatggaa
cataaaattgggcaaggtggttttggttcagtgtattatgctgagcttagaggcgagaaa
actgccataaagaaaatgggcatgcaagcaactcaagaattccttgctgaactgaaggtc
ttgacacatgttcaccacttgaatctggtgcgcctgattggttattgtgttgagaattgc
ttatttcttgtctatgaatttattgacaatggaaacctaagtcagcatctccaaaggact
ggttatgcgcctctctcatgggctaccagagtgcaaattgccctagactcagcacgtggt
cttgagtaccttcatgaacatgttgttccagtatatgttcatagggatatcaagtctgca
aatatcctattagacaaggacttccgggcaaagattgctgattttggactagcaaaactt
acagaagttggaagtatgtcgcagtcactgtcaacacgagttgctggtacatttggttac
atgcctccagaagctcgatatggtgaggtttctcctaaggtggatgtctatgcttttggt
gtcgtcctttatgaacttctttcagccaaacaagctattgtgagatcaagtgaatctgtt
agcgaatcaaaaggactggttttcctgtttgaggaggccctcagcgctccaaaccccacg
gaagctcttgacgaactgattgatccgagcctgcaaggggactaccccgtcgactcggct
ctcaagattgcgtcccttgcaaagtcctgcacgcatgaggagcccgggatgaggcctacc
atgagatccgtcgtcgttgccctgatggcgctcacagccaacaccgatcttcgcgacatg
gactaccaccctttctga

DBGET integrated database retrieval system