KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346217
Entry
4346217           CDS       T01015                                 
Name
(RefSeq) sorbitol dehydrogenase isoform X1
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa00051  Fructose and mannose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4346217
   00051 Fructose and mannose metabolism
    4346217
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     4346217
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 Methyltransf_25 AlaDh_PNT_C Sacchrp_dh_NADP TrkA_N Pyr_redox_3 UDPG_MGDP_dh_N hnRNP_Q_AcD MTS
Other DBs
NCBI-GeneID: 4346217
NCBI-ProteinID: XP_015650452
LinkDB
Position
8:27315915..27318262
AA seq 394 aa
MGKGGKGAEAAAAAVAGAGEEENMAAWLVAKNTLKIMPFKLPPVGPYDVRVRMKAVGICG
SDVHYLRVICCSLTERMKDNVAYICLLFECVQEMRIAHFVVKEPMVIGHECAGVIEEVGS
GVTHLAVGDRVALEPGISCWRCRHCKGGRYNLCEDMKFFATPPVHGSLANQIVHPGDLCF
KLPENVSLEEGAMCEPLSVGVHACRRADVGPETGVLIMGAGPIGLVTLLAARAFGATRVV
IVDVDEHRLSVARSLGADAAVRVSARAEDVGEEVERIRAAMGGDIDVSLDCAGFSKTVAT
ALEATRGGGKVCLVGMGHNEMTVPLTSAAIREVDVVGIFRYKDTWPLCIEFLRSGKIDVK
PLITHRFGFSQEDVEEAFEVSARGRDAIKVMFNL
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggggaagggagggaaaggagccgaggcggcggcggcggcggtggccggagccggtgag
gaggagaacatggcggcgtggctggtggcgaagaacaccctcaagatcatgcccttcaag
ctcccgccagttgggccttatgatgtccgtgtccggatgaaggcagtgggcatctgcggc
agcgacgtgcactacctcagggtgatctgttgttcgctcacagaaagaatgaaagataat
gtggcttatatatgtttgttgtttgagtgcgtgcaggagatgcgcattgcgcatttcgtg
gtgaaggagccgatggtgatcgggcacgagtgcgccggcgtgatagaggaggtcggcagc
ggcgtgacgcacctcgccgtcggcgaccgcgtggcgctcgagcccggcatcagctgctgg
cgctgcaggcactgcaagggcggccgctacaacctctgcgaggacatgaagttcttcgcc
acccctcccgtccacggatccctcgccaaccagatcgtgcaccctggtgatctgtgcttc
aagctgccggagaacgtgagcctggaggaaggcgccatgtgcgagccgctgagcgtgggc
gtgcacgcgtgccgccgcgccgacgtcgggccggagacgggggtgctgatcatgggcgcg
gggccgatcggcctggtcaccctgctggcggcgcgcgcgttcggcgcgacgcgcgtcgtg
atcgtggacgtggacgaacaccgcctctccgtggcccgatccctcggcgccgacgccgcc
gtgagggtgtcggcgcgcgcggaggacgtcggcgaggaggtggaacggatcagggcggcg
atgggcggggacatcgacgtgagcctggactgcgccgggttcagcaagacggtggcgacg
gcgctggaggcgacgcgcggcggcgggaaggtgtgcctcgtcgggatggggcacaacgag
atgacggtgccgctgacgtcggcggcgatcagggaggtggacgtggtggggatattccgg
tacaaggacacgtggccgctctgcatcgagttcctccgcagcggcaagatcgacgtgaag
ccgctcatcacccaccgattcgggttctcgcaggaggacgtggaggaggcgttcgaggtc
agcgcccgtggccgcgacgccatcaaggtcatgttcaacctctag

DBGET integrated database retrieval system