KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346252
Entry
4346252           CDS       T01015                                 
Name
(RefSeq) probable 26S proteasome non-ATPase regulatory subunit 3
  KO
K03033  26S proteasome regulatory subunit N3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4346252
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4346252
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4346252
SSDB
Motif
Pfam: Rpn3_C PCI DUF6366 Syja_N
Other DBs
NCBI-GeneID: 4346252
NCBI-ProteinID: XP_015650753
UniProt: A0A0P0XIP3 Q6ZJI3
LinkDB
Position
8:complement(27588400..27592069)
AA seq 486 aa
MTDVQMSDSEPQAAPPAAPAASALHHLKEIASVIEAGSLSKEVRRISRAVRLTVALRRRL
AARDVSAFLAFALPPSSEAYTRLTSLVPKEDDTEMDIDMAAPATQISIKHGLPEIEIYCY
LLVLIFLIDQKKYDDAKACANASIARLKNLNRRTVDVLASRLYFYYSYVHELTNSLAEIR
GNLLALHRMATLHRDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQFCRY
LFYLGKIRTIQLEYTDAKESLLQAARKAPITARGFRIQCNKWAIIVRLLLGEIPERTVFM
QKGMKEALTPYFELTNAVRIGDLELFRAVADKFVSTFSADRTRNLIVRLRHNVIRTGLRN
ISISYSRISLADIAKKLRLDSDNPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGDV
YSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELAKHMAE
EDDDDF
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgacggacgtgcagatgagcgactccgagccgcaggcggcgcctcccgcggcgccggcg
gcctccgccctccaccatctgaaggagatcgcctcggtgatcgaggccggctcgctgtcc
aaggaggtgcgccggatctcccgcgccgtccgcctcaccgtcgccctccgccgccgcctc
gccgcccgcgacgtctccgccttcctcgccttcgcgctcccgccttcctccgaggcctac
acccgcctcacctccctcgtccccaaggaagatgacactgagatggacattgacatggca
gctccagcaactcagatttcgatcaagcatggcctccctgagattgaaatatattgctat
ttgcttgtcctgatttttcttattgaccagaagaaatacgacgatgctaaagcatgtgca
aatgcaagcattgctcgtctgaaaaacttgaacaggagaactgttgatgttctggcatct
agactgtacttctattactcatatgtgcatgaactcaccaacagccttgctgaaatccgt
gggaatctgctagccttacacagaatggcaactcttcaccgcgatgaacttggccaggaa
actttgctcaacctgcttcttcgcaattacctccattataatttgtatgatcaagcagag
aaacttaggtcaaaagctcctcgttttgaagcccactccaatcaacaattctgtcgatac
ctgttctacttgggtaaaatcaggacaattcagttggagtacactgatgctaaggaaagc
cttctgcaagctgctcggaaggcacccattacagctcgtggctttcgtattcagtgcaac
aaatgggctattatagtgagactacttctcggagagattccagagaggactgtgttcatg
cagaagggaatgaaggaagcactgacaccctacttcgagcttacaaatgctgtcaggatc
ggtgatcttgaattgtttagggctgtcgccgacaaatttgtgagcacttttagtgctgac
aggactcgcaatttgattgtgagattgcgccacaatgttattcgaaccggactgcgcaat
attagcatttcatactcacggatctcccttgctgatattgccaagaagctaaggctcgac
tctgataatcctgttgctgatgcggagagcattgtagccaaggcaataagggatggcgca
attgatgccaccatagatcatgccaacggctggatggtgtcgaaagaaactggcgatgtc
tactcgacaaatgaaccacagattgcattcaactctcggattgcattttgcctcaacatg
cacaatgaagctgtgaaagcaatgcggttccccccgaactctcacaaggaaaaggaaagt
gcggagaagcgccgtgagaggctccaacaggaggaggagctggcaaaacacatggctgag
gaagatgacgatgatttttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347735
Entry
4347735           CDS       T01015                                 
Name
(RefSeq) probable 26S proteasome non-ATPase regulatory subunit 3
  KO
K03033  26S proteasome regulatory subunit N3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4347735
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4347735
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4347735
SSDB
Motif
Pfam: Rpn3_C PCI TPR_2 DUF6366
Other DBs
NCBI-GeneID: 4347735
NCBI-ProteinID: XP_015612691
UniProt: Q8W426 Q0IZY4
LinkDB
Position
9:complement(21338826..21342212)
AA seq 487 aa
MPEDVEMNDSQPQPAAAPPPAASTLQHLKEIASVIEAGSLTKEVRRISRAVRLTVALRRR
LAARDVAAFLAFALPHSSEAFARLSSLLPKEDGSEMDVDLAAPAAQVSIKHGLPEIEIYC
YLLVLIFLIDNKKYDEAKACASASITRLKNLNRRTVDVLASRVFTYYSYVHELTSSLAEI
RGTLLALHRMATLHRDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQFCR
YLFYLGKIRTIQLEYTDAKESLLQAARKAPTTARGFRVQCNKWAIIVRLLLGEIPERTVF
MQKGMKAALAPYFELTNAVRVGDLELFRAVAEKFASTFSADRTRNLIVRLRHNVIRTGLR
NISISYSRISLADIAKKLRLDSENPVADAESIVAKAIRDGAIDATIDHANGWMVSKETGD
VYSTNEPQIAFNSRIAFCLNMHNEAVKALRFPPNSHKEKESAEKRRERLQQEEELAKHMA
EEDDDDF
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgccggaggacgtcgagatgaacgactcccagccccagcccgccgccgcgccaccgccc
gcggcctccaccttgcagcatctgaaggagatcgcgtcggtgatcgaggccgggtcgctg
accaaggaggttcgccggatctcccgcgccgtgcgcctcaccgtcgcgctccgccgccgc
ctcgccgcccgtgacgtcgccgccttcctcgccttcgcgctgccgcattcctcggaagcc
ttcgcccgcctttcctccctcctgcccaaggaagatgggagtgaaatggatgttgatttg
gcagctccagcggctcaagtgtcaattaagcatggtctcccagagattgaaatatactgt
tacttgcttgtgctgattttccttattgataataagaaatatgatgaggctaaagcatgt
gcttctgcaagcattactcgtttgaagaatcttaacaggagaacagtcgatgttttagct
tctagggttttcacctattactcttatgtccacgaactcaccagcagccttgctgaaatt
cgtggaactcttctggcattgcacagaatggcaactttacatcgtgatgagcttggtcag
gaaactctactcaacctgcttcttcgcaactacctgcactacaacttgtatgaccaagca
gaaaagcttaggtccaaggcaccgcgttttgaagcacattctaatcagcagttctgcagg
tatctgttctacttgggaaaaattaggacaattcagttggagtacactgatgcaaaggaa
agcctactgcaagctgctcgaaaggcacccactacagctcgtgggttccgagttcagtgc
aacaagtgggctatcatagtgagattacttttaggagaaataccagagagaactgttttt
atgcagaaaggaatgaaggctgctttggcaccatattttgagcttacaaatgctgttcga
gttggggaccttgaattgttcagagcagtggcagaaaaatttgctagcactttcagcgcg
gataggacgcgcaatttgatagtgaggctgcgccacaatgtcattcggactggattgcgc
aacataagcatttcatactcacggatctcccttgctgacattgccaagaagctgaggttg
gactcagagaaccctgttgctgatgctgaaagtattgtagccaaagcaatcagggatggg
gcaattgatgccaccattgatcatgccaatggttggatggtgtcaaaagagactggtgat
gtctactcaacgaatgagccacagattgctttcaattcaaggattgcattttgcttgaac
atgcacaacgaagcggtcaaagcactgaggttccctccgaattctcacaaggaaaaggag
agtgctgagaagaggcgcgagaggctccaacaggaggaagaactagcaaaacacatggct
gaggaggacgatgacgacttttag

DBGET integrated database retrieval system