KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346290
Entry
4346290           CDS       T01015                                 
Name
(RefSeq) phosphatidylinositol-3-phosphatase myotubularin-1
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4346290
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4346290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4346290
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     4346290
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     4346290
Protein phosphatases and associated proteins [BR:osa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    4346290
SSDB
Motif
Pfam: Myotub-related Y_phosphatase3 Y_phosphatase DUF2959 bPH_3 PTPlike_phytase DSPc
Other DBs
NCBI-GeneID: 4346290
NCBI-ProteinID: XP_015650270
LinkDB
Position
8:complement(27858996..27868334)
AA seq 827 aa
MDGSGSWDAIDWNQIKEPRPPRSSSRGMEDFLLEDEEVYAQGHGVVLLNTDEAGILSVTN
FRLLFVSQATKGVIELGTIPLTAIEKINDDVKLQPLPRQHDKKQPRELLQVIGKDMRVIV
FDFLPKTKQKNEVFDALRRYSKPTHLWDLYAFSCDPSTVYQKSDPKMRLLKEYHRLFRKW
FPHSGSEFEKDLRNEWWRVSKVNSTYSLCSTYPSALIVPRSISDEDLLQASSFRSGRRLP
VISWCDPGSGAVLARSSQPLVGLMMNFRNNTDEKLVSALCTQIIDATGSLRKLYIVDARP
RANALANGAKGGGSESASNYPRSEVLFLGIQNIHTMRDSLFRLRDYVDTHGSVSSNGTSS
AVSLVGDRRNRGSTWGGGNLNSMTQFSSMLGEWLNHIQSIMVGASWIAAQIVQESASVLV
HCSDGWDRTTQLVALACLLLDPYYRTFNGFQALVEKDWLAFGHPFAERMGVPTITDNNSG
SQFELLRQPSLGTLSNSPNRGALGSSVSTSNTTSGQSQTSNNSSPILLQWLDCISQLLRL
YPSAFEFSSKFLVDFMDCVLSCRFGNFLCNSEREREQSGAVSSCHCMWTYLADLRASGGS
FHKHRNPFYDPLKHNGPLVPPAAALAPTLWPQFYLRWTCPIESQGGDLESQWHAMNKKYT
EAMKAKDTAESRVKDIKTKMESMQLELQREKRASSSALAMAQRAQRESVAIRKAVRSLGC
TVNFGTNESQVEKTEGLTYSFRRDTDFESQHEKSSDFSVSITAIEDSLVSETPSNHICES
LCPFRTREGCRWPDAACAQLGSQFVGLKANFDAFDRLSVQDSYFGSE
NT seq 2484 nt   +upstreamnt  +downstreamnt
atggacggctccggcagctgggacgccatagactggaaccaaatcaaggagccgaggccg
ccgcggagttcgtcccggggcatggaggacttcctcctcgaggatgaggaggtttacgcc
cagggtcatggtgttgttctactaaacacagatgaggctggcattctttcagtgacaaat
ttccgacttctctttgtgagccaagccacaaaaggcgttatagagttgggtaccatccca
ctaactgcaattgagaagataaatgatgacgtaaagcttcaacccttgccccgccagcat
gataagaagcagccccgtgaacttcttcaagtcatcggtaaagacatgagggtcattgtg
ttcgattttcttcctaaaaccaagcagaaaaacgaagtgtttgatgctttgagaagatat
agcaaacctactcatctgtgggatctatatgcattttcttgtgatccctccactgtttat
cagaaatctgatccaaagatgcggctcttgaaggaataccatcgcctttttaggaaatgg
ttcccgcatagtggatccgagttcgaaaaagacttgcgtaatgaatggtggagggtaagt
aaagtaaattccacctactcactatgttcgacgtacccatctgcattgattgtgccaagg
agcataagtgatgaagatttattgcaagcttcttctttccgatccggcagacgcttgcct
gttatttcgtggtgtgaccctgggtctggagctgttctggcaaggtcatctcagccattg
gtaggattgatgatgaattttcggaacaataccgatgagaagcttgtttctgctctttgc
acccaaattattgatgccactgggtctctaaggaagttatatatagttgatgcccggcca
agagcaaatgctttagcaaatggtgcaaagggaggtggctcagagtcagcatcaaactac
ccaagatctgaggttctctttttaggaatacaaaatatccacacaatgagagatagtctt
tttcgccttagggactatgttgatacccatggatcagtatcatcaaatggaacatcatca
gctgtatctcttgttggagaccggagaaatcgtggatcaacctggggtggagggaatctg
aatagcatgacacaattttcttcaatgttaggggagtggctaaaccatatccagagtatc
atggtcggtgcttcgtggattgctgcacaaattgtccaagaatcagcttctgttctcgtc
cattgcagtgatggttgggaccgcacaactcagttggttgcacttgcttgtttgttgctt
gatccatattatagaacgttcaatgggttccaggcccttgtggaaaaggattggctagca
tttggccatccatttgcagagcgaatgggagttccaacgataactgataataatagtgga
tcacagtttgagctgctaagacaaccttctcttgggactttgagcaattcaccaaacaga
ggtgctttaggatcatcagtgtcaacgtctaatactacttctggtcaatcccagacatca
aacaactcttcacccatactgttacagtggctggattgtatttctcagttgttacgtttg
tatccatctgcatttgagttctcatctaaattccttgttgactttatggattgtgtgttg
tcatgccgctttgggaacttcttgtgcaatagtgagcgagaaagggagcaatctggtgct
gtaagctcttgccattgcatgtggacgtacttggctgatctccgagcttctggtggcagc
ttccataagcatcgtaatccattctatgatccattaaagcataatggtcccctagtgcca
cctgctgcagcacttgctcctaccctttggccccaattttatttgagatggacatgcccc
attgaatctcaaggtggtgatcttgaatctcaatggcatgccatgaataaaaagtacaca
gaagcaatgaaggcaaaggacacagctgaatcaagggtaaaagatattaaaacgaagatg
gaatctatgcaattagaattacagagggagaagcgtgcaagtagttcagccttggccatg
gctcaacgtgctcaaagggagagcgttgccatcagaaaggcagtgcgatcgttgggctgt
acggttaatttcggcacgaatgaaagccaggtggagaaaactgaggggctgacatattca
tttcgaagagacacagattttgagtcccagcacgaaaaaagttccgacttctctgtatcc
atcaccgcgattgaggacagcttggtttcagaaacaccaagcaaccatatctgtgagtca
ctctgccctttccgcaccagggaaggatgtagatggcctgatgcagcgtgtgcacagctt
ggaagccagtttgttggtctaaaggcaaattttgatgccttcgaccggctatcggtacaa
gacagctattttggttcagaatag

DBGET integrated database retrieval system