KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346314
Entry
4346314           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S25-2
  KO
K02975  small subunit ribosomal protein S25e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4346314
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4346314
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4346314
  Archaea
    4346314
SSDB
Motif
Pfam: Ribosomal_S25 MarR_2 HTH_24 AIPR PCI DUF5764 TrmB
Other DBs
NCBI-GeneID: 4346314
NCBI-ProteinID: XP_015649393
UniProt: A0A0P0XJH5 Q6YZI2
LinkDB
Position
8:27973015..27974647
AA seq 108 aa
MAPKKDKAPPPSSKPAKSGGGKQKKKKWSKGKQKEKVNNSVLFDQATYDKLLSEVPKYKQ
ITPSVLSERLRINGSLARRAINDLMTRGLIRMVSVHSSQQIYTRATNT
NT seq 327 nt   +upstreamnt  +downstreamnt
atggccccgaagaaggacaaggccccgccgccgtcgtcgaagccggccaagtccggcggt
ggcaagcagaagaagaagaagtggagcaagggaaagcaaaaggagaaggtgaacaactcg
gtgctgttcgaccaggccacctacgacaagctgctctccgaggtgcccaagtacaagcag
atcaccccctccgttctctctgagagactcaggatcaacgggtccctggctcgtagggcc
atcaatgatttaatgacacggggcctaatccgcatggtctcggttcactcaagccagcag
atctacaccagggcaaccaacacctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347899
Entry
4347899           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S25-2
  KO
K02975  small subunit ribosomal protein S25e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4347899
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4347899
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4347899
  Archaea
    4347899
SSDB
Motif
Pfam: Ribosomal_S25 HTH_24 MarR_2 AIPR TrmB
Other DBs
NCBI-GeneID: 4347899
NCBI-ProteinID: XP_015612251
UniProt: A0A0P0XRU1 Q652P8
LinkDB
Position
9:complement(22701722..22703192)
AA seq 108 aa
MAPKKDKAPPPSSKPAKSGGGKQKKKKWSKGKQKEKVNNSVLFDQATYDKLLSEVPKYKQ
ITPSVLSERLRINGSLARRAMKDLMDRGLIRMVSVHCSQQIYTRATNT
NT seq 327 nt   +upstreamnt  +downstreamnt
atggccccgaagaaggacaaggccccgccgccgtcgtccaagcccgccaagtccggcggt
ggcaagcagaagaagaagaagtggagcaagggaaagcaaaaggagaaggtgaacaactcg
gtgctgttcgaccaggccacctacgacaagctgctctccgaggtgcccaagtacaagcag
atcaccccctccgtcctctccgagcgcctcaggattaatgggtccctggctaggagggct
atgaaggatctgatggatagggggcttatcaggatggtgtcggttcattgcagccaacag
atttacaccagggcaacgaacacatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349810
Entry
4349810           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S25
  KO
K02975  small subunit ribosomal protein S25e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4349810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4349810
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4349810
  Archaea
    4349810
SSDB
Motif
Pfam: Ribosomal_S25 MarR_2 HTH_24 HTH_11 AIPR DUF2103
Other DBs
NCBI-GeneID: 4349810
NCBI-ProteinID: XP_015617530
UniProt: A0A5S6RA05 Q53QG2
LinkDB
Position
11:2522116..2528140
AA seq 108 aa
MAPKKDKAPPPSSKPAKSGGGKQKKKKWSKGKQKEKVNNSVLFDKATYDKLLSEVPKYKQ
ITPSVLSERLRINGSLARQAIKDLESRGAIRVVSVHSSQLIYTRATNA
NT seq 327 nt   +upstreamnt  +downstreamnt
atggcgccgaagaaggacaaggccccgccgccgtcctcgaagccggccaagtccggcgga
ggcaagcagaagaagaagaagtggagcaaggggaagcagaaggagaaggtgaacaactcg
gtgctgttcgacaaggccacctacgacaagcttctctccgaggtgcccaagtacaagcag
atcaccccctccgtcctctccgagaggctcaggatcaatgggtcgctcgctcgacaggcc
atcaaggatcttgagtcaagaggcgccatcagggtggtgtctgtacattcgagccagcta
atctacaccagagccaccaacgcttga

DBGET integrated database retrieval system