KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346337
Entry
4346337           CDS       T01015                                 
Name
(RefSeq) puromycin-sensitive aminopeptidase isoform X2
  KO
K01256  aminopeptidase N [EC:3.4.11.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4346337
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4346337
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     4346337
Peptidases and inhibitors [BR:osa01002]
 Metallo peptidases
  Family M1
   4346337
SSDB
Motif
Pfam: DUF3458_C Peptidase_M1 DUF3458 Peptidase_M1_N Peptidase_M61 DUF3093
Other DBs
NCBI-GeneID: 4346337
NCBI-ProteinID: XP_015649851
UniProt: B7EA73
LinkDB
Position
8:complement(28173381..28181769)
AA seq 887 aa
MDLPKEIFLKEYKKPDYLFDSVNLEFQLGEDKTIVTSKIAVSPGTEGTSSPLTLHGRDLK
LLSIKVNGKDLKSEDYMVDSRHLTVSRPPGGTFNLEIVTEIYPQLNTSLEGLYKSTGNFC
TQCEAEGFRKITYFQDRPDVMATYTCRIEADKTLYPVLLSNGNLIEQGDLEGGKHYALWE
DPFKKPSYLFALVAGQLDCREDSFTTCSGRKVTLRIWTPGQDLAKTAHAMYSLKAAMKWD
EEVFGLEYDLDLFNIVVVPDFNMGAMENKSLNIFQSRLVLASPETATDGDYAAILGVVGH
EYFHNWTGNRVTCRDWFQLTLKEGLTVFRDQEFSSDLGCRTVKRIADVSKLRTYQFPQDA
GPMAHPIRPHSYIKMDNFYTVTVYEKGAEVVRMYKTMFGASGFRKGMDLYFQRHDGQAVT
CEDFYAAMCDANNTQLPNFLQWYSQAGTPTVKVSSSYDASSQTFSLKFSQEVPPTPGQPV
KEPMFIPIAVGLVDSTGKDMPLTSIYSDGMLQSLTSDGQPVFTTVLQFNKKEEEFIFNNI
PEKPVPSLLRGYSAPVRLDSDLTESDLFFLLANDSDEFNRWEAGQVLSRKLMLSLVADFQ
QQKTLALNPKFVDGLRSILRNTSLDKEFIAKAITLPGQGEIMDMMPVADPDAVHAVRTFI
KKELALQLKDDLLSTVTNNRSSEAYTFNHDSMARRALKNTCLAYLASLNEPDTTELAFVE
YKSATNMTEQFAALAALSQNPGQVRDDTLLDFYNKWQHDYLVVSKWFALQATSDIPGNVA
NVQKLLGHPAFDMRNPNKVYSLIGGFCGSPVNFHAKDGSGYKFLGEVVLQLDKINPQVAS
RMVSAFSRWRRYDESRQALAKAQLEMIVSANGLSENVYEIASKSLAA
NT seq 2664 nt   +upstreamnt  +downstreamnt
atggatcttccaaaggagatattcctgaaagaatacaaaaagcctgattacttatttgac
tcggtcaatttggaatttcaacttggcgaagacaaaacaatagttacatctaaaatagct
gtatctccaggaactgaaggtacctcctctccacttactcttcatgggcgtgatctgaag
ctgctatcaatcaaagtcaatggcaaggaccttaagagtgaagattatatggttgattca
cgccatttgactgtttcaagaccacctggtggtacattcaacttggaaattgttacagaa
atatatcctcagctaaatacatcattggagggactttacaagtcaactggcaatttttgc
acccagtgtgaagcagaagggttccggaagattacatactttcaggatcgtccagatgtt
atggcaacatatacttgccgtatcgaagctgataagacgttgtatccagtactgttgtcc
aatgggaatcttatagagcagggggatcttgagggtggcaagcattatgcattgtgggaa
gaccccttcaagaaaccaagctacttatttgctttagttgctggtcagttggattgcagg
gaggactcatttactacatgttctggccgaaaagtaacacttagaatttggactcctggt
caagatttagcaaagacagcgcatgctatgtattctcttaaagcagctatgaagtgggat
gaggaggtttttggccttgaatatgatcttgatttgttcaatattgttgttgttccagat
ttcaatatgggagcaatggagaacaagagcttaaacatatttcaatctagacttgtgctg
gcatcaccagagacagctactgatggggattatgctgcaattttaggtgtcgttggacat
gagtatttccacaactggactggtaatagagtgacttgtcgtgattggttccagctcact
ctgaaagaaggattgactgtattccgggatcaggaattctcatcagatcttggttgtcgc
acagtaaaacgtatagccgatgtttctaaactcaggacctatcaatttccacaggatgct
ggccctatggcgcatcctattcgtccgcattcgtatatcaagatggacaatttttatacc
gtaacggtttatgaaaagggtgctgaagttgttagaatgtacaagaccatgtttggagct
tcagggtttcgaaagggcatggatctttacttccaaaggcacgacgggcaagctgtgact
tgtgaagacttttatgctgcaatgtgtgatgcaaataacacccagctgccaaacttttta
caatggtactctcaggcaggtactccaactgttaaagtgagctcttcatacgatgcaagt
tctcagacattttctctgaaatttagtcaagaagtgccacctacccctggccaaccagtt
aaagagccgatgttcattcctattgctgtcggacttgttgattctaccggaaaggatatg
cccctaacttccatttacagtgatgggatgctccaatcactcactagtgatggccagcca
gtcttcactactgttcttcaatttaataagaaggaggaagaattcatatttaacaacata
cctgagaaaccagtgccttccttgttgaggggatacagtgctcctgttcgtcttgattct
gatctgactgagagtgacttgtttttcctacttgccaatgattcggatgaatttaacagg
tgggaagctggtcaggtgctgtcacgtaaactgatgctcagtcttgtagctgacttccag
caacagaaaacactggccctgaaccctaaatttgttgatggacttagatcaatcctgcgg
aacacaagcttggataaagaattcattgcgaaagcgataactttgccgggtcaaggggag
attatggatatgatgccagttgcagatcctgatgcagttcatgctgtccgtacctttatt
aagaaggagcttgcccttcaactcaaagatgaccttctttcaacagtgacaaataacaga
agttctgaagcttatacatttaaccatgatagcatggcccgccgtgcattgaaaaacaca
tgccttgcttatcttgcatctctgaatgaaccggacaccactgaacttgcatttgttgaa
tacaagtctgctactaacatgacggagcagtttgctgcactagcagcattgtctcaaaat
ccaggccaagttcgtgatgacacccttctggacttctataacaaatggcagcatgattat
ttggttgtaagcaagtggtttgctcttcaagctacatcagacatccctggaaatgttgct
aacgttcaaaagttacttggtcaccctgcttttgacatgaggaatccgaacaaggtgtat
tcgctaattggaggattttgtgggtcccctgtgaatttccatgcaaaagatggctctggt
tacaagttcttgggtgaagttgttttacagctagacaagataaatcctcaggtggcctcc
cgcatggtgtcagctttctctcggtggaggcgatatgatgagagcagacaagctcttgct
aaggctcagctggagatgatcgtgtcagccaatgggctatcagagaatgtgtacgagata
gcttcaaagagcctggcagcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352123
Entry
4352123           CDS       T01015                                 
Name
(RefSeq) putative leucine aminopeptidase 1
  KO
K01255  leucyl aminopeptidase [EC:3.4.11.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4352123
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4352123
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     4352123
Peptidases and inhibitors [BR:osa01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   4352123
SSDB
Motif
Pfam: Peptidase_M17 Peptidase_M17_N PDZ_6
Other DBs
NCBI-GeneID: 4352123
NCBI-ProteinID: XP_015619002
UniProt: Q2QSB9
LinkDB
Position
12:14109094..14114458
AA seq 537 aa
MEGHTAPTLGLTMPNVVDPPQISFAAKDMDLTEWEGDILAVLVTETDVSKATSSSSRFTN
AAAALAKLDGELGGLLSEASAEEEFAGRAGQSVALRLPTAPGLHGFKRVCLVGVGNNMPS
SAAACRSTGETIAAVAKSAQARSAAVALASPPPGWVQGEDLRLNAAAAVASGVVLGLHED
RRYKSDSKKVHLKQVDLIGFGSGQEMGRKLQYANHVSSAVIFAKELVNSPANVLTPAVLA
EEASNIASSYSDVLTATILDEEKCRELKMGSYLAVAAASANPPHFIHLCYKPPGGNVKRK
LAIVGKGLTFDSGGYNIKIGAVTTIELMKKDMGGSAALFGAAKALGQIKPPGVEVHFISA
ACENMISGTGMRPGDIVTASNGKTIEVDNTDAEGRLTLADALVYACKLGVDKIIDLATLT
GYCRIALGPSIAGILTPSDELDKEVAAAYEASGEKFWRLPLEESYWEQMKSSVADMLNTG
SPLGGAITAGLFLKQFVDEKVKWMHVDMAGPVWNYKKQEATGFGVSTLVEWVLINSS
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggaaggacacaccgcccccactctcggcctcaccatgcccaacgtcgtcgatcctcct
cagatcagttttgccgccaaggacatggacctcaccgagtgggagggagacatcctagcc
gtccttgtgaccgagaccgacgtgtccaaggcgacatcatcaagctccaggttcacgaac
gccgccgcagcgctggcgaagctcgacggcgagctcggcggcctcctgtcggaggcgtcg
gcggaggaggagttcgccgggagagccgggcagtcggtggctctccggctccccacggcg
ccggggctccacggtttcaagagggtgtgcctcgtcggcgttggcaacaacatgccgtcc
tcagctgcggcttgccggagcaccggcgagaccatcgcggcggtcgccaagtccgcgcag
gctcgcagcgccgccgttgctctcgcctcgccgccgccgggttgggttcagggagaggat
cttaggctgaatgctgctgcggcagtggcttctggagttgtgcttgggttgcacgaggac
aggagatacaagtctgactccaagaaggtgcatctcaagcaagtagatcttatcggattt
ggctccggccaagagatgggcaggaaacttcagtacgccaaccatgtttcctcagccgtg
atcttcgccaaagagcttgtgaactcacctgcaaatgtccttacccctgctgttctcgcg
gaggaggcatcgaacattgcttctagttacagtgacgtgttgacggcgacgatattagac
gaggagaaatgcagggagctgaagatgggttcgtacttggcagttgctgcagcctctgca
aatcctccacactttatacacttgtgctacaaaccccctggaggaaatgtcaagagaaag
ctagcaattgttgggaagggcctcacattcgacagtgggggctacaacattaagattgga
gcagtcaccactattgagctgatgaagaaagatatgggtggctctgcagcattgtttggt
gcagcaaaagctttgggccaaatcaagcctcctggagtagaggttcattttatttctgct
gcatgcgaaaatatgataagtggcacaggcatgaggcctggtgacattgtgactgcttct
aatggaaaaactattgaggtggacaacactgatgcagaaggaaggcttacacttgctgat
gctttggtatatgcctgtaaactgggtgttgacaagattattgatctggcaacacttact
ggttactgcagaattgcacttggtcctagcattgctgggattttgactccaagtgatgaa
ctggacaaggaagtcgctgccgcatatgaggcatcaggagagaagttctggagactgcca
ctagaagaaagctattgggagcaaatgaagtctagcgttgctgatatgcttaacaccggt
agtccgctgggtggtgcaattacggctggactatttctgaagcagtttgttgatgagaaa
gtgaagtggatgcacgttgacatggctgggccggtttggaactacaaaaagcaagaagcc
accggattcggcgtgtccacattggtggagtgggtcctcatcaactcgtcttag

DBGET integrated database retrieval system