KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346376
Entry
4346376           CDS       T01015                                 
Name
(RefSeq) DNA repair protein RAD51 homolog 4 isoform X1
  KO
K10871  RAD51-like protein 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4346376
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4346376
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     4346376
SSDB
Motif
Pfam: Rad51 ATPase DnaB_C RecA AAA_25 divDNAB ATPase_2
Other DBs
NCBI-GeneID: 4346376
NCBI-ProteinID: XP_015612422
UniProt: A0A075DNI2
LinkDB
Position
9:complement(485012..490861)
AA seq 283 aa
MAMAATSASGGAGCFPRPPPSGGEEKKQDEEGQCFLDGMDLLKDATENKRFLPTGLQGVD
ALLGGGLRQGQLTEITGQSSSGKTQVCLCSASHVAARQLGVVMYLDTSNSFSPSRIARIV
DGFPISLVREPKNVRLERVMSSIICKSVFDIFDLFEVLHQLELSLKSKVNNGGNKICLLI
IDSISSILAPINGGKYPRGRSMMISVAMILKKLAYEHNLSVLVTNHMVAGNGAPKPALGE
SWKTVPHVRLVISRERGSKICAATVLKHTLLASGRVMKFAVPS
NT seq 852 nt   +upstreamnt  +downstreamnt
atggcgatggcggcgacgtcggcgagcggcggcgccggctgcttccccaggcctcctccc
tccggcggcgaggagaagaagcaagatgaggaggggcaatgctttctggatggaatggac
ttgctcaaggatgcgacggagaacaagcgcttcctccccacgggccttcaaggcgtcgac
gcgcttcttggaggcggcctgcgccaaggtcagctcactgaaataaccggccaatcgtcc
tccggtaaaacacaggtctgtctttgttctgcttcacatgtggcagccaggcagttgggt
gttgttatgtacttggatactagcaattccttttcccctagccgcattgctcgaatagtt
gatggattccccatctctttggtcagagagccaaagaatgtgcgactcgagagggtcatg
agcagcatcatttgtaagtcagtctttgatatattcgatttgtttgaagtgctacatcaa
cttgaattgtcactgaagagcaaggtaaacaatgggggtaacaagatatgcttgcttatc
attgactcaatatcgtctatacttgctcccatcaacggtgggaagtatccacgagggcga
tcgatgatgatatcagtggctatgattctaaagaagctagcatatgagcataatctatct
gttctggttactaaccatatggttgctgggaatggagctcccaagcctgctcttggtgag
agctggaaaactgttccacatgtccgcttggtgatatctcgtgagcgtggtagcaaaatc
tgcgcagcaactgtgctgaagcacacactactggcttcgggccgtgttatgaaatttgcc
gtaccaagctga

DBGET integrated database retrieval system