KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346459
Entry
4346459           CDS       T01015                                 
Name
(RefSeq) tropinone reductase-like 3
  KO
K11147  dehydrogenase/reductase SDR family member 4 [EC:1.1.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa01100  Metabolic pathways
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4346459
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.-
    1.1.-.-
     4346459
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-GeneID: 4346459
NCBI-ProteinID: XP_015651170
UniProt: Q0J3C1 Q6K447
LinkDB
Position
9:complement(2512445..2517272)
AA seq 253 aa
MEVKCRRLEGKVAVVTASTQGIGLAIAERLGLEGAAVVISSRKKKNVDEAVVGLRAKGIT
VVGVVCHVSIPEQRKNLIDTAVKNFGHIDIVVSNAAANPSVDNILEMKEPILDKLWDINV
KASILLLQDAAAYLRKGSSVILISSITGYNPEPALSMYAVTKTALLGLTKALAAEMGPNT
RVNCIAPGFVPTNFARFLTTNDTIKNELIDRSTLKRLGTVEDMAAAAAFLASDDASFITA
ETIVVAGGTRSRL
NT seq 762 nt   +upstreamnt  +downstreamnt
atggaggtgaagtgccgtcggctggaggggaaggtagccgtcgtgacggcctccacgcag
ggcatcggtctcgccatcgccgagcgcctcggcctcgagggcgccgccgtcgtcatctcc
tcccgcaagaagaagaacgtcgacgaggcggtcgtgggcctcagggcgaaggggatcacc
gtcgtcggggtggtctgccatgtctccatcccggagcagcgcaagaacctcatcgacacg
gcggtcaagaattttgggcatatcgacatagttgtctccaatgctgctgccaatccttcc
gtagataacatattagaaatgaaagagcctatccttgacaaactatgggatattaatgtt
aaggcatctattcttcttcttcaggatgctgctgcatatttgcggaagggatcatccgtg
atattgatttcttcaattactggctataatccagaaccagcattgtcgatgtatgctgtt
acaaaaactgccctgcttggtctcacaaaggctcttgctgctgagatggggccaaatact
cgtgttaactgtatagcccctggttttgttcctacaaattttgctcgtttcctcacaact
aatgacaccattaaaaatgagcttattgacaggagcacacttaagagattgggtactgtg
gaagacatggctgcagccgcagctttcttggcatcagacgatgcatcattcattacagct
gaaactattgttgttgctggaggaactcgatctaggctgtag

DBGET integrated database retrieval system