KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347127
Entry
4347127           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor TFIID subunit 10
  KO
K03134  transcription initiation factor TFIID subunit 10
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4347127
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4347127
   03036 Chromosome and associated proteins [BR:osa03036]
    4347127
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     4347127
   Coactivators
    SAGA/TFTC/STAGA complex
     4347127
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     4347127
    STAGA complex
     4347127
    TFTC complex
     4347127
    SAGA complex
     4347127
    SLIK complex
     4347127
SSDB
Motif
Pfam: TFIID_30kDa
Other DBs
NCBI-GeneID: 4347127
NCBI-ProteinID: XP_015651287
UniProt: Q69MK0 Q0J1L3
LinkDB
Position
9:complement(15781363..15784898)
AA seq 165 aa
MMGSNSAGGGGGGAMVPGGMGGGGPMGAAAAGGGGGGDGRHDDEAVLTEFLSSLMDYTPT
IPDELVEHYLGRSGFYCPDLRLTRLVAVATQKFISDIASDSLQHCKARVAAPIKDNKSKQ
PKDRRLVLTMDDLSKALQEHGVNLKHPEYFADSPSAGMAPAAREE
NT seq 498 nt   +upstreamnt  +downstreamnt
atgatggggagcaacagcgcaggcggaggcggcggtggcgccatggttccggggggcatg
gggggaggagggcccatgggggcagccgccgccggcggcggcggcggcggagacgggcgg
cacgacgacgaggcggtcctcaccgagttcctctcctccctcatggactacacccctacg
attcccgacgagctggtggagcactaccttggccgcagcggcttctactgccccgacctc
cgcctaacgaggctggttgctgtagccacccaaaagttcatttcggacattgcaagcgac
tctcttcagcactgcaaagccagggtagcagcacctatcaaagataacaagagcaagcaa
cctaaggataggcgtcttgtgttaacaatggatgatctttccaaggccttgcaagagcac
ggtgtgaacttgaaacatcctgagtacttcgcagacagcccttctgcaggaatggctcct
gcagcaagagaagagtag

DBGET integrated database retrieval system