KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347318
Entry
4347318           CDS       T01015                                 
Name
(RefSeq) phosphoribosylaminoimidazole-succinocarboxamide synthase, chloroplastic
  KO
K01923  phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00048  De novo purine biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4347318
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     4347318
SSDB
Motif
Pfam: SAICAR_synt
Other DBs
NCBI-GeneID: 4347318
NCBI-ProteinID: XP_015611710
UniProt: A0A0P0XN09 Q6YXG8
LinkDB
Position
9:17742538..17746486
AA seq 403 aa
MSPSAPPSALRLRGLPKASLPASSSFPPSARFPHHLSMSASSSRRPPPLAATAAAAGTGS
GASPSLLAADPGHRDAVLLAARGAMANCLGETSLHLAVPGLRLAAKGKVRDVYESGEHLV
LVTTDRQSAFDRVLASIPFKGQVLNETSLWWFDRTRHITPNAVVSSPDKNVTIAKRCSVF
PVEFVVRGYVTGSTDTSLWTVYNKGARNYCGNVLRDGMVKNQKLSANILTPTTKAADHDV
PVTPEEIINSGLMSKEDFDEARSKALSLFAYGQEVALENGLILVDTKYEFGKTADGTIML
IDEVHTPDSSRYWIADSYEERFSSGLEPENVDKEFLRLWFKNNCNPYEDAVLPEAPEELV
CELAWRYIFLFETITNTKFEIPKTQEPIHERISRNVAQALQNL
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgtctccctccgcgccgccgtccgccctccgcctccgggggcttcccaaggcttcgctg
ccggcctcctcctctttcccgccctccgctcgcttcccccaccacctctccatgtccgcc
tcctcgtctcgccgccctccgcccctcgccgcaacggcggcggccgccgggaccgggagt
ggcgcctccccatccctcctcgcagccgacccgggccaccgcgacgccgtcctcctcgcc
gctcgcggcgccatggcgaactgcctcggcgagaccagcctccacctcgccgtccccggg
ctccggctcgcggccaagggcaaggtgagggacgtgtacgagagcggggagcatctggtg
ctggtcaccaccgaccggcagagcgcgttcgatcgcgtcctggcttccatccctttcaag
gggcaggtgctcaacgaaacaagcctttggtggttcgataggacccgtcatatcactcca
aatgcagtagtttcttctcctgataagaatgtgacaattgcaaaaaggtgctcagttttt
ccagttgaatttgttgtgaggggatatgttactggaagcactgatacatctttgtggact
gtttataacaaaggtgcgaggaactattgtggaaatgttctacgtgatggaatggtaaag
aatcagaagctatctgcaaatatacttacaccaacaactaaagctgcagatcatgatgtt
cctgtcactcctgaagagattatcaattcaggactaatgtcaaaggaagattttgatgaa
gcaagaagcaaagccttaagcttatttgcatatgggcaggaagtggccttagagaatgga
ctgattctagttgacacaaagtatgagtttggaaaaacagctgatgggacaatcatgttg
attgatgaggtacacactcctgactccagcagatattggattgctgattcttacgaagag
agattcagttctggtcttgagcctgaaaatgttgacaaggagttcttaagactctggttc
aagaacaattgcaatccatacgaagatgcggttctgcctgaagctccagaagaactagtt
tgtgaactagcttggcggtacattttcctgtttgagacaattacaaacacaaagttcgag
atccccaaaactcaggagccgattcacgaaagaatatcaaggaatgttgcacaagccttg
cagaacctttga

DBGET integrated database retrieval system