KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347432
Entry
4347432           CDS       T01015                                 
Name
(RefSeq) glucosamine 6-phosphate N-acetyltransferase 1
  KO
K00621  glucosamine-phosphate N-acetyltransferase [EC:2.3.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4347432
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.4  glucosamine-phosphate N-acetyltransferase
     4347432
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_CG FR47 Acetyltransf_9 Acetyltransf_6
Other DBs
NCBI-GeneID: 4347432
NCBI-ProteinID: XP_015610795
UniProt: Q5U9F2
LinkDB
Position
9:complement(18822892..18826297)
AA seq 165 aa
MEQPLPTAAAEAAAAGGDGEAYRIRPLELADISRGFLGLLNQLSPSPPLTEEAFRARFEE
LAALGADHLVLVAEDAATGRLAAAGAVLVERKFIRRCGRVGHVEDVVVDAAARGRGLGER
VVRRLVEHARGRGCYKVIINCTPELTGFYAKCGFVEKNVQMGLYF
NT seq 498 nt   +upstreamnt  +downstreamnt
atggaacagccgctccccaccgccgcggcggaggcggccgccgccggcggcgacggcgag
gcctaccggatccggccgctggagctcgccgacatctccagggggtttctgggcctcctc
aaccagctctccccctcgccgcccctcacggaggaggccttccgcgcgcggttcgaggag
ctcgcggcgctgggcgccgaccacctcgtcctcgtcgcggaggacgccgccacgggccgc
ctcgccgccgcgggggccgtgctcgtggagcgcaagttcatacggcggtgcggccgggtg
gggcacgtcgaggacgtcgtggtggacgccgccgcgcgcggccgcgggctcggggagcgc
gtcgtgcgccgcctcgtggagcacgcgagggggaggggttgctacaaggtcatcatcaac
tgcaccccggagctgacggggttctacgccaagtgcgggttcgtggagaagaacgtccag
atggggctctacttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266241
Entry
9266241           CDS       T01015                                 
Name
(RefSeq) probable glucosamine 6-phosphate N-acetyltransferase 2
  KO
K00621  glucosamine-phosphate N-acetyltransferase [EC:2.3.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    9266241
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.4  glucosamine-phosphate N-acetyltransferase
     9266241
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_CG FR47 PMAIP1
Other DBs
NCBI-GeneID: 9266241
NCBI-ProteinID: XP_015626803
UniProt: C7IZ16
LinkDB
Position
2:29792793..29795079
AA seq 166 aa
MASTSPEPSTAAAVAETGCSVQIRRLEATDHEKGFVALLSQLSACPDLTASEFAACFADL
AALGDDHVILVAEDPAAPESRILATGCLFVERKFLRGGGKVGHVEDVVVDAAARGRGLGL
RVVRRLVEIAKEAGCYKVILDCTPELRAYYAKCGFVEKGVQMAIYF
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcatccacctcgccggaaccctccaccgccgccgccgtcgcggagaccggctgttcc
gtccaaatccgtcgcctggaggcgacagaccacgagaagggattcgtggccctcctctcg
cagctctccgcctgcccggacctcaccgcgtccgagttcgccgcgtgcttcgccgacctc
gcggccctcggcgacgaccacgtcatcctcgtggccgaggaccccgccgccccggagagt
cggatcctcgccacggggtgcctcttcgtggagcgcaagttcctgcgcggcggcgggaag
gtggggcacgtggaggacgtcgtggtcgacgccgccgcgcgcggccgcgggctcgggctc
cgcgtcgtgcgtcgcctcgtggagatcgccaaggaggccggatgctacaaggtcatcctc
gactgcacgcccgagctacgcgcgtactatgccaagtgcggattcgtggagaagggggtt
cagatggcaatctacttctga

DBGET integrated database retrieval system