KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347482
Entry
4347482           CDS       T01015                                 
Name
(RefSeq) DNA topoisomerase 3-beta
  KO
K03165  DNA topoisomerase III [EC:5.6.2.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4347482
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4347482
   03400 DNA repair and recombination proteins [BR:osa03400]
    4347482
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     4347482
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Topoisomerases
   4347482
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     4347482
   FA (Fanconi anemia) pathway
     4347482
SSDB
Motif
Pfam: Topoisom_bac Toprim DUF5795
Other DBs
NCBI-GeneID: 4347482
NCBI-ProteinID: XP_015612275
UniProt: Q0J0S6
LinkDB
Position
9:19369184..19382950
AA seq 866 aa
MAPTVLMVAEKPSIALSIASALSGGRMSTRKGSTDVHEFDGMFQGSHAFFKVTSVIGHVL
SVDFPPAYQNWEGTDPMDLFVAPVLRSECNPKAHIRRHLAQEARGCTYLVLWLDCDREGE
NICYEVIDCTGIPKSEVGRRIFRAKFSSVTEKDIMDAMNNLVLPSKDEALAVDARQEIDL
KVGVAFTRFQTRYFQGKYGNLDSRVISYGPCQTPTLGFCVQRYQQITTFKPEKFWSLKTY
VIKDGNEIQLEWDRKKLFDFDVTVMFQKMVASDGILKVTDISVKEECKARPPGLNTVNLL
KVASSALGIGPQTAMHLAERLYTQGFISYPRTESTAYPSSFDFRSALAALAHNPLWSNDV
RTLLDTGFVKPKQGHDAGDHPPITPMRLATEEALGTDAWRLYQYICQHFIGTVSPDCRYT
RTSIEFTSGGETFHCVGNRVTSKGFTSIMPWLAVSENNIPAYKKGDAVSIHKVDIYEGST
TPPDYLSESELISLMEKNGIGTDASIPVHVNNICERNYVQVNSGRRLVPTPLGTTLIRGY
QCIDADLCLPDIRRFIEQQITLIAKGEADHLQVVQHVLQQFMKKYSYFVKKIENMDALFE
AQFSPLADSGRLLSKCGKCARYMKYISTQPMRLYCVTCEEVYYLPQNGSIKLYKEIICPL
DGFELLLFSMVGPDAKSFPLCPFCYNSPPFEGIDKLFGALKLDDTGKVGKGAGMPCFLCL
HPTCKQSMITQGVCACPECTGTLILDPVSAPKWRLYCNRCNCIVLLPHAAHKISTTDKKC
PTCESTIIEVDFNKKTTPLKDGATLHEGCILCDELLHSLIEMKHGKSFFMRRGRGRGRGR
GRGRGSSRGRRGSSRHDDPKMSFRDF
NT seq 2601 nt   +upstreamnt  +downstreamnt
atggcgcccacggttctgatggtcgcggagaagcccagcatcgcgctctccatcgcctcc
gccctctccggcggccgcatgtctacaaggaagggaagtacagatgtccatgagtttgat
gggatgtttcagggttctcatgcatttttcaaagtgacatcagtcattggacatgtcttg
agtgtagattttccacctgcatatcagaattgggaagggactgatccaatggatctattt
gtggctccagttctgcgatctgaatgcaaccctaaggctcatatccgcaggcatctagct
caggaagctcgaggctgcacctacttggtactctggcttgattgtgaccgagaaggagaa
aacatatgctatgaagtaattgattgcactggaattcctaaaagtgaggttggcagaaga
attttccgagccaaattttcgtccgttactgagaaagatataatggatgctatgaataat
cttgttttgccaagtaaagatgaggcactagcagttgatgctcgccaagaaattgacttg
aaggtaggagtagcatttactcgatttcaaaccagatattttcaaggaaaatatggaaat
ctcgactcaagagtaatttcgtatggtccatgccaaacacctacacttggattctgtgta
caacgctatcagcagattaccacattcaaaccagagaaattttggtccttgaaaacttat
gttatcaaggatggtaatgaaattcagcttgaatgggataggaagaaactttttgatttt
gatgttactgtaatgttccaaaagatggtggccagtgatggtattttaaaagtaaccgac
atatcagtgaaggaagagtgcaaagcccgcccgcctggccttaatacagttaatttgctt
aaggttgcatcaagtgcactaggtattggacctcagacagcaatgcacttggcagaaagg
ctttatacccaaggattcatcagttatccacgtacagagagcactgcctatccttcatca
tttgattttagaagtgcactcgctgcacttgcacataatcctttgtggtccaatgatgtt
cggacgttactggacactgggtttgttaagcccaaacagggtcatgatgctggggaccat
cccccaataactccaatgagattggcaacagaagaagctttgggaactgatgcttggagg
ctgtaccagtacatttgtcagcattttattggcactgtcagtcctgattgtagatatacg
aggacttccattgagttcacttcaggtggagagactttccactgtgttggcaaccgggtc
acttctaaaggatttacttctattatgccatggctggctgtgagtgagaataatatccct
gcatataaaaagggcgatgctgttagcatccataaggttgacatatatgagggtagcacc
acacctcctgactaccttagtgagagtgaattgatctctctcatggagaagaatggcata
ggtacagatgcatcaattcctgtgcatgtaaacaacatctgcgagcgtaattatgttcag
gtgaattccggaagaagattagtaccaacacccctgggaactacattgataagagggtat
cagtgcattgatgctgatctgtgcttaccagatatccgaaggtttattgagcagcagatt
actctaattgcaaaaggtgaagctgaccatcttcaagttgtgcagcatgttcttcagcag
tttatgaaaaagtactcgtactttgtgaaaaagattgaaaacatggatgctttgttcgaa
gcacagttttcacctttggctgactctggacgtttactgagcaagtgtggaaaatgtgct
cggtatatgaagtacatttccactcagccaatgaggctgtactgtgtaacttgtgaagag
gtctactatcttccccagaacggttccattaagctttacaaggaaatcatttgccccctt
gatgggtttgagttgctactgttttcaatggttggccctgatgcaaaatccttcccactg
tgtcctttttgctacaacagtcctccatttgaaggcatcgacaaactcttcggtgcactc
aagcttgatgacactggcaaggttgggaaaggggctggcatgccatgcttcctctgcctg
caccccacatgtaaacaatctatgatcactcaaggagtttgtgcttgtcctgagtgtact
ggtaccctaattcttgatccagtcagcgcacccaaatggcggctttactgcaatagatgt
aactgcattgtcctgctcccacatgccgctcataagatcagtactacagataagaagtgc
ccaacatgtgagtctactatcatcgaagttgattttaacaagaaaactaccccacttaag
gatggagctactttgcatgagggttgcatcttgtgcgatgagctgttgcattcgctcatt
gagatgaagcatgggaagtcattttttatgaggagaggtagaggaagaggcaggggtaga
ggtcgagggagaggaagcagtaggggaagacgggggagctcaagacacgatgatcctaag
atgagcttcagagatttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269718
Entry
9269718           CDS       T01015                                 
Name
(RefSeq) DNA topoisomerase 3-alpha isoform X1
  KO
K03165  DNA topoisomerase III [EC:5.6.2.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    9269718
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    9269718
   03400 DNA repair and recombination proteins [BR:osa03400]
    9269718
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     9269718
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Topoisomerases
   9269718
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     9269718
   FA (Fanconi anemia) pathway
     9269718
SSDB
Motif
Pfam: Topoisom_bac Toprim zf-GRF zf-C4_Topoisom
Other DBs
NCBI-GeneID: 9269718
NCBI-ProteinID: XP_015631257
UniProt: C7J0A2
LinkDB
Position
3:complement(3488790..3500401)
AA seq 928 aa
MHHGGGGGAIRVLNVAEKPSVAKSVAEILSRPSGGMRSREGRSRYNRVFEFDYSIGGRAC
HMLVTSVTGHLMELEFDDRFRRWHSCDPADLFHAPVRKSVPQDKQDIKRTLEEEARKCQW
LVLWLDCDREGENIAYEVIDICAGANSRLNIWRARFSALIDREIHEAVQHLDRPNKLFAD
AVDARQEIDLRIGASFTRFQTMLLKDAFVLDDTGDDRNIILSYGPCQFPTLGFIVERFWE
IQAHEPEEFWTINCSHTSDEGTASFGWIRGHLFDYSSAVVIYEMCVEEPMATVQNVRNQE
KLKYPPYPLSTIELQKRASRYFRMSSEHTMKVAEELYQAGFISYPRTETDNFSPNTDLHS
IVHEQVAHPNWGTYAQRLLDPEARLWRNPSNGGHDDKAHPPIHPTKFSAGETNWTDNHKK
LYELVVRHFLACCSQPAVGAETTVEIDIAGEQFNASGRVVLAKNYLDVYRFDSWGGTLLP
TYIIGQQFVPTTLTLDSGMTRPPPLLAEADLLGCMDKAGIGTDATMHDHIKKLLDRCYAT
KDANTRFSPTNLGEALVMGYDEMGYELWKPYLRSMMEADMKSVSIGTKSKSEVLENCLQQ
MKACFLDARANKVKLFDAMGTFFARSSRPVNETQNSIETVRPCAACNESEMFLKQRPTGE
FMVGCRGFPQCRNVVWLPRSLSGAAVTDQVCPTCAPGPVYKIQFKFRRRDIPPNFDVDHL
GCIGGCDDILKELMELSRFGSHSQTATPARNQSQTASGVRQGSSRQDLHTSFHPAVQFTN
GQTPVVNPQGFRSTHTQSSGNASGQVQCTSCREPCVLRTANTEANRGRKFYKCQNLACGF
FAWEDDVENSAPRGRGGRGRGGRSSSRQSSASASAGRRGGTQGRGRRGRGRNADGMMFVA
ATGEPVYGSCFICGDPTHFANVCPNLGR
NT seq 2787 nt   +upstreamnt  +downstreamnt
atgcaccacggcggcggcggcggcgcgatccgcgtgctgaatgtggcggagaagccgtcg
gtggcgaagtccgtcgcggagatcctgtcgcggccgtcgggcgggatgcggtcgcgggag
gggcggtcacggtacaaccgcgtcttcgagttcgattactccatcggcggccgcgcctgc
cacatgctcgtcacctccgtcacggggcacctcatggagctcgagttcgacgaccggttc
cgccgctggcactcgtgcgaccccgctgatctcttccacgcccccgttcgcaagtccgta
ccccaggataagcaagacataaaaagaacattggaagaggaagccaggaagtgtcagtgg
cttgtgctttggcttgattgtgatagagagggtgagaatatcgcatatgaagtgattgat
atatgcgcaggtgccaacagccgcctcaacatttggagagctcgtttctcagctttgatt
gacagggaaatccatgaagctgtgcaacatcttgacagacccaacaagctctttgctgat
gctgttgatgcaagacaggaaattgaccttcgcatcggtgcctccttcacaaggttccag
acaatgctgctgaaagatgcatttgttcttgatgacactggtgatgataggaatataatt
ctgagttatggtccttgccagtttccaaccctaggatttattgttgagcgtttctgggag
attcaagctcatgaacctgaagagttctggacaataaattgttcccacacttcagatgaa
ggcactgcatcttttggttggatacgtggtcatttgtttgattactcatctgctgttgtg
atctatgaaatgtgtgttgaagaaccaatggcgacagtgcaaaatgtaaggaatcaagag
aaactaaaataccccccatatccactaagtaccatagagcttcagaaacgtgcctctagg
tacttcagaatgagttccgagcacacaatgaaggtggctgaggaactttatcaagctgga
tttattagttatcccaggacagagactgataacttctctccaaacactgacctacattcc
atcgtacatgaacaagtggctcatccaaattggggaacatatgctcagcgtcttttggat
cctgaagcaagactttggagaaaccccagcaatggtggtcacgatgacaaggcacatcct
cctattcatccaacaaaattttcagctggggaaacaaattggactgataatcacaaaaaa
ttgtatgagcttgttgttcgccatttccttgcttgttgctcccaacctgcagttggagct
gaaacaactgtggaaattgacattgctggtgaacagttcaatgcatcagggcgcgttgtt
cttgctaaaaattatttggacgtatatcggtttgactcatggggcggtacattacttccg
acatacatcattggacaacagtttgttccaacaactttaacgcttgattctggaatgact
cgcccacctcctctgcttgctgaagctgacctccttggttgtatggataaagcaggaatt
ggcactgatgcaacgatgcatgatcacataaaaaagttacttgaccgttgttatgcaacc
aaagatgcaaatacacggttctccccaacaaatctaggcgaggcattggtgatgggttac
gatgaaatggggtatgagctttggaaaccttatttaagatcaatgatggaagctgatatg
aaatcagttagcattggtacaaagagtaaatcagaagtacttgagaattgtttgcagcaa
atgaaggcttgttttcttgatgcaagggcaaacaaggtgaaactctttgatgcaatggga
acattctttgcaaggtcaagtagaccggtcaatgagacacagaactccatagaaactgtg
agaccatgtgctgcatgcaatgaatctgaaatgtttctgaagcaaaggccgactggcgaa
tttatggttgggtgtcggggcttccctcaatgtagaaatgtagtttggctcccacgatct
ctttcaggggctgctgtgactgatcaagtttgtcctacctgtgctccaggtccggtttat
aagattcaatttaagtttcggcgaagggatattccaccaaattttgatgtcgatcacctc
ggttgtattggtggatgtgatgacatactcaaagagctcatggaattaagtagatttgga
agtcatagccagactgcaacaccagcaagaaatcagagccagactgcaagtggtgtaagg
caggggtcttcaaggcaagatttacatactagctttcatccagccgtgcaatttactaac
ggacaaacacctgttgtgaatcctcaaggttttcgttcaacccatacccaaagctcagga
aatgcatcaggtcaagtacagtgcacatcatgtcgagaaccctgcgtattgcgaactgct
aatacagaggctaacagggggaggaagttctataaatgccagaatcttgcatgcggcttt
ttcgcatgggaagacgatgtggagaactctgcgccgaggggccgtggcgggcgtgggcgg
ggcgggcgcagtagcagcaggcaatcatctgcatctgcatctgcagggcggagaggcggc
acccaagggcgaggcaggaggggcagaggacggaatgctgatggcatgatgttcgttgcg
gcgacgggcgagcccgtttacggcagctgcttcatctgcggcgaccctacccacttcgct
aatgtctgccccaacctcgggagatag

DBGET integrated database retrieval system