KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347821
Entry
4347821           CDS       T01015                                 
Name
(RefSeq) cysteine--tRNA ligase, chloroplastic/mitochondrial isoform X1
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4347821
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4347821
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4347821
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     4347821
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   4347821
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4347821
 Prokaryotic type
    4347821
SSDB
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1f tRNA-synt_1 MAP65_ASE1 PP_kinase_N
Other DBs
NCBI-GeneID: 4347821
NCBI-ProteinID: XP_015612101
UniProt: Q0IZQ2
LinkDB
Position
9:complement(22114222..22119985)
AA seq 569 aa
MAAARRAAGLLPLLLSSPSRARLPHRQALALTPPLLRPHRLYSHSPKPSSSAAFSAFASA
SNGAPAGRARELHLYNTKSRRKELFQPRVPGGEVGMYVCGVTPYDDSHIGHARAYVAFDV
LYRYLRYLDHKVRYVRNFTDIDDKIIARANQLGEDPFSLSKRYSDDFLSDMANLHCLPPS
VEPRVSDHIDQIINMIKQIIDNDCAYAIGGDVYFSVENFPEYGDLSGRKLDDNRAGERVA
VDERKKNPADFALWKAAKDGEPSWDSPWGPGRPGWHIECSAMSAHYLGHSFDIHGGGEDL
IFPHHENEIAQSRAACCDSSINYWIHNGFVNVNSQKMSKSLGNFVTIRKVTELYHPLALR
MFLLGTHYRSPINYTIEQLNVASDRLYYTYQTLQDCEESCQQHQSKAGDPLPVNTTNCIQ
KLHDEFETSMSDDLHTSVALAAISEPLKVMNDLLHTRKGKKQEKRLESLSAMEEKIRMVL
SVLGLLPSSYYEALQQLREKALRRASMTEEQVLQKIEERTSARKAKQYEKSDEIRKELAA
VGIALMDGPDGTTWRPSVPLSEQGVVAST
NT seq 1710 nt   +upstreamnt  +downstreamnt
atggcggcggcgaggcgcgccgctggcctcctccctctcctcctctcctcgccgtcgcga
gctcgcctaccgcaccgccaagcgcttgccctgacccctcctctgcttcgcccccaccgc
ctctactcccactcccccaagccctcgtcgtccgccgcgttttccgccttcgcctccgcc
tcgaatggcgcgcctgcggggagagcccgggagctgcacctctacaacaccaagtcgcgg
aggaaggagctcttccagccccgggtgcccggcggggaggtcggcatgtacgtctgcggc
gtcaccccctacgacgacagccacatcggccacgcccgcgcctacgtcgccttcgacgtc
ctctacaggtacttgcgttatttggaccataaagtgcgctatgttcggaattttactgac
attgatgacaagataattgcaagagcaaatcaattgggagaagatccttttagcttaagc
aaaaggtactctgatgacttcctatcagacatggctaatcttcattgtttaccaccatct
gtggagcctcgcgtttcagaccacattgatcagattataaacatgattaaacagatcatt
gataatgattgtgcatatgcaattggcggggatgtttatttctctgttgaaaatttccct
gaatatggggatttatctggtcgaaaattagatgataatagagctggtgaaagggttgct
gttgatgagaggaagaagaacccagctgattttgctctttggaaggctgcaaaagatggg
gagccatcttgggatagcccttggggccctggaaggccaggatggcacatagaatgcagt
gctatgagtgcacattacttgggccactctttcgacatacatggcggtggggaggacctg
atctttccacaccatgaaaatgaaattgctcagagccgtgcagcatgttgtgacagcagc
ataaattactggatacacaatggctttgtcaatgtaaacagccagaaaatgtcaaaatcg
ctgggcaactttgtcactatacgcaaagttacggaactgtaccacccacttgctttgagg
atgtttttacttggtacacactacaggtccccaatcaactataccatagaacagcttaat
gttgcatcagacagactgtactacacttaccagacactacaagattgtgaagaaagttgt
caacagcaccaaagcaaggctggagatccattacctgttaatactacaaattgtatccag
aagctccatgatgaatttgagacttcaatgtctgatgatcttcacacttcagtagcactg
gctgctatttctgagccattaaaagttatgaatgacttgctgcatactcgtaagggaaag
aagcaggaaaaacggctggaatcactttctgctatggaagagaaaataaggatggtgctt
tctgtcctagggctactaccatcaagctattatgaggctctgcagcagctgcgggaaaaa
gcactaagaagagcttccatgacagaggagcaggtgcttcagaaaattgaagaaaggact
tcagcaagaaaggcaaaacagtatgaaaaatccgatgaaatcagaaaagaattggctgct
gttggaattgccctcatggacggtcctgacggaacaacttggaggccatctgtacctctt
tctgagcaaggggtggttgccagtacatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348825
Entry
4348825           CDS       T01015                                 
Name
(RefSeq) cysteine--tRNA ligase, chloroplastic/mitochondrial isoform X1
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4348825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4348825
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4348825
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     4348825
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   4348825
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4348825
 Prokaryotic type
    4348825
SSDB
Motif
Pfam: tRNA-synt_1e tRNA-synt_1 tRNA-synt_1g VSG_B DALR_2 tRNA-synt_1f Tra1_central
Other DBs
NCBI-GeneID: 4348825
NCBI-ProteinID: XP_015613840
LinkDB
Position
10:17063000..17066825
AA seq 412 aa
MYELQCLPPTHEPRVTKHIEQIIDLITKIMDNGKAYTIEGDVYFSVDNFPDYLSLSGRKV
DQNRPGTRVAVDARKRNPADFALWKSAKEGEPSWESPWGRGRPGWHIECSAMSAHYLGNI
FDIHGGGKDLIFPHHENELAQSQAAYPESEVKCWMHNGFVNKDGQKMAKADKNFFTIRDI
ISLYHPMALRLFLMRTHYRSDVNHSDTALQFASGRLYYIYQTLHDGEETVSLYGEHKLEN
SIPADDQKLIEENRSNFLEKMSDDLHTTAALDHLMVPLRAINNNLSDLKKLQQKLEHQKK
KQSQKQQQQQQKKPEDYIQALVALQNEVTDKLSILGLMPMSSLAEDKALKRAGMTAEQLQ
QMIEQRTLARKNKDFAESDRIRTELSALGIALMGEPTGTLWRPSEPELAEGS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgtatgaacttcagtgccttccccctactcatgagccacgtgtaacaaagcacattgag
cagataatagatttgataaccaagataatggacaatgggaaagcctatacaattgaagga
gatgtgtatttctctgttgataacttccctgattatctgagtttatctggaaggaaggta
gaccaaaaccgtcctggaacacgagtcgctgttgatgcaagaaagcgaaatcctgcagac
tttgcattatggaagtctgctaaggagggtgagccatcttgggagagcccttggggtcgt
ggaaggccaggatggcatattgagtgcagtgcgatgagcgctcattatttgggtaatatt
tttgatattcatggtggaggaaaagatttgatctttcctcatcatgagaatgagctcgca
caaagccaagcagcttatcctgagagtgaggtaaaatgctggatgcataacgggtttgtc
aacaaagatggccagaaaatggctaaggcagataagaatttcttcaccatcagagatatt
atttctctgtaccatcccatggctttaagattatttctgatgcgtacacattatagatca
gatgtaaaccactctgatacagctcttcagtttgcatctggccgtctatattatatttat
cagactctacatgacggtgaagaaactgtgtcgttatatggtgaacacaagttggaaaac
tcaataccggctgatgatcaaaagttgatcgaagagaaccgttcaaattttcttgagaaa
atgtcagatgatctgcatacaacggctgctcttgatcacctgatggtgccactaagagca
ataaacaacaacctaagcgatctgaagaagttgcaacaaaagctagaacaccagaaaaag
aaacaatcacagaagcagcagcagcagcaacagaaaaaaccagaagattatatccaagct
ctggttgccttgcagaatgaagtcaccgataaactttccatccttggcttaatgccaatg
tcatctttggctgaggacaaggcattgaagcgagctggcatgactgcagagcaattgcaa
caaatgatcgaacaaagaacgcttgccaggaagaacaaggacttcgccgagtctgaccgg
atcagaacagagctctctgctctcgggattgctttgatgggtgagcctactgggacatta
tggaggccatctgaaccagaactagctgaaggatcgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270000
Entry
9270000           CDS       T01015                                 
Name
(RefSeq) cysteine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    9270000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    9270000
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    9270000
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     9270000
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   9270000
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    9270000
 Prokaryotic type
    9270000
SSDB
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f GCP_C_terminal PXA DALR_2 LIM_bind YonK tRNA_lig_CPD Topoisom_I_N CT_C_D Ndc1_Nup FKBP_N
Other DBs
NCBI-GeneID: 9270000
NCBI-ProteinID: XP_015632797
UniProt: Q10RX2 A0A8J8YCC8
LinkDB
Position
3:complement(2396764..2400590)
AA seq 528 aa
MAESAKPTPQLELFNSMTKKKELFEPLVEGKVRMYVCGVTPYDFSHIGHARAYVAFDVLY
RYLKFLGYEVEYVRNFTDIDDKIIKRANEAGETVTSLSSRFINEFLLDMAQLQCLPPTCE
PRVTDHIEHIIELITKIMENGKAYAMEGDVYFSVDTFPEYLSLSGRKLDHNLAGSRVAVD
TRKRNPADFALWKAAKEGEPFWDSPWGRGRPGWHIECSAMSAHYLGHVFDIHGGGKDLIF
PHHENELAQSRAAYPESEVKCWMHNGFVNKDDQKMSKSDKNFFTIRDIIDLYHPMALRFF
LMRTHYRGDVNHSDKALEIASDRVYYIYQTLYDCEEVLSQYRGENISVPVPVEEQDMVNK
HHSEFLESMADDLRTTDVLDGFTDLLKAINSNLNDFKKLQQKLEQQKKKQQQQKQQKQKQ
QQAQKQPEEYIQAMFALETEIKNKISILGLMPPSSLAEALKQLKDKALKRAGLTEELLQE
QIEQRTAARKNKQFDVSDQIRKQLGSKGIALMDEPTGTVWRPCEPESE
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggcggagagcgcgaagccgacgccgcagctggagctcttcaactcgatgacgaagaag
aaggagctcttcgagccgcttgtggaggggaaggtccgcatgtatgtgtgcggcgtcacg
ccctacgacttcagccacatcggccacgcccgcgcctacgtcgccttcgacgtcctctac
aggtatcttaaattcttggggtacgaggtcgaatatgtgcgcaacttcactgatattgat
gacaagattatcaaacgagcaaatgaagctggtgaaactgtaactagcttgagcagccgg
tttattaatgaattccttctcgatatggctcagctccagtgcttacccccaacttgtgag
ccacgtgtgacggatcacattgaacatattatagagttgataaccaagataatggagaat
gggaaagcctatgctatggaaggagatgtttacttttcagttgatactttccctgagtat
ctcagtttatctggaaggaagttagatcataatcttgctggttcgcgggttgctgtcgat
acaagaaagcggaaccctgcagactttgcgctgtggaaggctgctaaggaaggcgaacct
ttctgggatagcccatggggccgtggtagaccaggatggcatattgaatgcagtgcaatg
agtgctcattatttaggacatgtgtttgatatccatggtggagggaaagatctgatattt
cctcatcatgagaatgagcttgctcagagccgggcagcttatccagaaagtgaggtcaaa
tgttggatgcacaatgggtttgttaacaaggatgatcagaaaatgtcaaagtcagataaa
aatttcttcacaatccgagatattattgatctgtaccatcccatggctttgaggtttttc
ctgatgcgcacacattacagaggagatgtgaatcactctgacaaagcacttgagatagca
tctgatcgtgtctactacatatatcagactttatatgactgtgaggaagtgttgtctcaa
tatcgtggagagaatatctctgtcccggtccctgttgaggaacaagatatggttaacaag
caccattcagaattcttggaatctatggcggatgatcttagaacaacagatgttctggat
ggctttactgacttgctgaaggcaattaacagcaatttgaatgattttaagaagttgcaa
cagaagctagagcagcaaaagaagaaacaacaacagcagaagcagcagaagcaaaagcag
cagcaggcacagaaacaaccagaagaatatattcaagctatgtttgcacttgagacagaa
attaaaaataaaatatctatccttggtctgatgccaccttcttccttggcagaggcactg
aagcaacttaaggataaagctttgaagagagcagggttgactgaagaactgttgcaggag
caaattgagcagagaactgctgcaaggaaaaacaagcagtttgatgtgtctgaccaaatc
aggaaacagctaggcagcaaaggcatagccctcatggatgaacctactggtacagtatgg
agaccatgcgagccagagtctgaatag

DBGET integrated database retrieval system