KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347985
Entry
4347985           CDS       T01015                                 
Name
(RefSeq) U1 small nuclear ribonucleoprotein 70 kDa
  KO
K11093  U1 small nuclear ribonucleoprotein 70kDa
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4347985
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4347985
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   U1 snRNP specific factors
    4347985
 Complex B
    4347985
SSDB
Motif
Pfam: U1snRNP70_N RRM_1
Other DBs
NCBI-GeneID: 4347985
NCBI-ProteinID: XP_015614284
UniProt: Q33BE1 Q0IZA1
LinkDB
Position
10:complement(1007650..1012940)
AA seq 463 aa
MGDYGSGMMRGNPDGGGMQSRTKGQRVNVQQLKLMGQGHPTGLTPNLLKLFEPRPPLDFK
PPVEKRKLPAYTGMAQFVSQFAEPGDPEYAPPVPTCETKAEKKDRIRKSKLDQGAAKVAE
ELQKYDPQSDPNATGDPYKTLFVARLNYETSEHRVKREFEAYGPIKRVRLVTDKETNKPR
GYAFIEYMHTRDMKNAYKQADGRKVDNRRVLVDVERGRTVPNWRPRRLGGGLGSSRIGGE
NAEQKLSTRDQQHAGRPRSEEPRRDERRADRDREKSRERPRERDRDERTRERSHDRTRER
DSKEDRHHHRDRDRTRDRERGRDRERDHGRDRDRERDRRDRDRDRDRGRDYERDRDRGHD
RHRERGRDRERDYERASHERDRGHMHERDAEFANGEPKHDQEYGYNYEQHKSHDAYETER
SKRHEHEYYQMQPNNTEPEGPEEGEAYDEGDYQYHQAADEHNN
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgggcgactacggcagcgggatgatgcgggggaacccggacggcggcgggatgcagtcc
cgcaccaagggccagcgcgtcaacgtgcagcagctcaagctgatggggcagggacacccg
acgggcctcacccccaacctgctcaagctcttcgagccccgcccgccgctcgacttcaag
ccgcccgtcgagaagcgcaagttgccggcctacactgggatggcgcagttcgtgtcgcag
tttgcggagcccggtgaccctgagtacgcgccacccgtccccacatgcgagaccaaggct
gaaaagaaggataggatccgcaaaagtaagcttgaccaaggtgcggctaaggtggctgaa
gagcttcagaaatatgacccacagagtgaccccaatgccactggagatccatacaaaaca
ctctttgttgcaagacttaactatgagacgtctgagcatagggtcaagcgggagtttgaa
gcttatgggcctattaaaagggtacggcttgtgaccgacaaggaaacaaataaacctaga
ggatatgcattcatcgagtatatgcacacccgggacatgaaaaatgcttacaagcaagca
gatgggagaaaagtggacaataggagggtgctagttgatgtggagcgtggtagaactgtt
ccaaattggcgtcccaggagattgggtggtggacttggatcaagcagaattggtggtgaa
aatgctgaacagaagctctccactagggatcagcagcacgctggacgcccaagatcggag
gagcctaggagagatgagcgtcgtgcagatagggaccgcgagaagtctcgtgaaaggcca
cgggaaagagatcgtgatgagagaactcgtgaacgatcccatgaccgtactcgcgagcgt
gattcaaaagaagatagacaccaccatagggatcgggacaggactcgggacagggaacga
ggaagggaccgggagagagatcatggtcgtgaccgtgaccgtgagcgtgatcgtcgtgat
agagatagggacagggatcgtggtcgggattatgagagagaccgtgaccgtggtcatgat
cgccatcgtgagagaggcagggaccgtgagagagattacgagcgtgcaagtcatgaacgg
gaccgtggtcacatgcatgagagagatgctgaatttgccaacggtgagccaaaacatgat
caggaatatggctataactatgagcaacacaaaagccatgatgcttatgagacggagcgc
tcaaagcgacatgagcatgagtactatcagatgcaacctaacaacacagaacctgaaggc
cctgaagagggcgaggcatatgatgaaggtgactaccagtatcaccaagctgctgatgag
cacaataactga

DBGET integrated database retrieval system