KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348080
Entry
4348080           CDS       T01015                                 
Name
(RefSeq) alpha-mannosidase isoform X1
  KO
K01191  alpha-mannosidase [EC:3.2.1.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4348080
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4348080
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     4348080
Membrane trafficking [BR:osa04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Selective cargos
    4348080
SSDB
Motif
Pfam: Glyco_hydro_38N Glyco_hydro_38C Alpha-mann_mid Glyco_hydro38C2
Other DBs
NCBI-GeneID: 4348080
NCBI-ProteinID: XP_015614375
UniProt: Q10A56 A0A8J8XJ79
LinkDB
Position
10:2477211..2489742
AA seq 1004 aa
MASSSSALVVVVAVLALAEAAVAFSGYNTSAGAVAGKLNVHLVPHSHDDVGWLKTIDQYF
VGTNNSIQGACVMNTLDSVVDALILDPARKFVFAEQAFFQRWWAEKSPKIQAIVHKLVDS
GQLEFINGGWCMHDEAAVHYIDMIDQTTLGHRVIKKQFNKIPRAGWQIDPFGHSAVQGYL
LGAELGFDSMHFARIDYQDRAKRKGDKGLEVIWRGSRTFGSSSQIFTNAFPVHYSPPDGF
GFEIFDDFVPVQDDMLLFDYNLKERVNDFVAAALKQANVTRTNHIMWTMGDDFNYQYAES
WFRNMDRLINYVNKDGRVHALYSTPSIYTDAKHASNESWPLKYDDYFPYADAKNAYWTGY
FTSRPTFKRYIRMISGYYLAARQLEFLVGRSSLGLFTSSLEDPLGIAQHHDAVSGTAKQH
TTDDYSKRLAIGVSQVEKGVNTALSCLTSSKGTCTATKFSQCQLLNISYCPSTEEGISSA
KSLVIVVYNPLGWERSDFVRVPVNDANLIVKTSDGTSLESQLVEVDIVTARLRKLYIKAY
LGITSDKPPKYWLVFQASVPPLGWNTYFISKSTGTGSNGMGYVSTMVSPSNDTIEIGPGP
LKMSYSSKSGQLKRMFNSISAVDLPIQQSFLWYASSTGDSEDSQASGAYIFRPNRTTPTI
VSGMAPLKVIHGPLVDEVHQQFSSWIYQVTRLYKNKEHAEVEYTIGPIPVDDDDDIGKEV
VTRLTTNMATNKIFYTDSNGRDFLERVRNHRDDWDLNLSQPVAGNYYPVNQGIYVADGKY
ELSVLVDHAVGASSIQDGQIEVMLHRRLSADDGRGVGEPLNEVVCVDQKCDGLVARATYY
INVNKKGHGAHWRRTYSQQVYSPFLVAFAHEDERSWKSNNIAKASTVEGNYSLPDNVAII
TLQSLDDGTTLLRLAHLFQAQEDTQYSVMAKVELRKLFGKRIIKDLTETSLSANQKKSEM
KKLNWRVTGESKTDPAPLKGGPVDSHALVVELGPMEIRTFLLKF
NT seq 3015 nt   +upstreamnt  +downstreamnt
atggcgtcgtcgtcgtcggcgctggtggtggtggtggcggttcttgcgttggcggaggcg
gcggtggcgttctcggggtacaacacgagcgccggggcggtggccgggaagctgaacgtg
cacctggtgccgcactcccacgacgacgtcgggtggctcaagaccatcgaccagtacttc
gtcggcaccaacaactccatccagggcgcgtgcgtgatgaacacgctcgactccgtggtg
gacgcgctcatcctggaccccgcgcgcaagttcgtcttcgcagagcaggctttcttccaa
agatggtgggcagagaaaagcccaaaaatccaggccatagtccacaagctagttgattct
ggtcagctagagttcataaatggtgggtggtgtatgcatgatgaagccgccgtccattat
attgacatgattgatcagaccacacttggtcatcgggtaatcaagaaacagtttaacaag
atcccaagagctggctggcaaattgatccttttggtcattctgcagttcaaggttatttg
cttggggcagagcttggtttcgattctatgcattttgcgagaatcgattaccaagataga
gcaaagcgtaaaggagacaaaggcctagaggttatatggcgcggctcaagaacatttggt
tcatcttctcagatcttcacaaatgcatttcctgtccattatagccctccagatggcttc
ggcttcgaaattttcgatgattttgtacctgtacaggatgacatgttgctgtttgactac
aatcttaaagaacgtgtgaatgattttgttgctgcagccttaaaacaggcaaatgttacg
cgcacaaaccacataatgtggactatgggggacgattttaattaccagtatgctgagtct
tggttccggaacatggacaggcttatcaattatgtgaacaaggatggccgtgtgcatgca
ctgtactctactccatctatttacacagatgcaaaacatgcgtcgaatgaatcatggcca
ctcaaatacgatgattatttcccgtatgctgatgcaaaaaatgcttactggactggatat
tttacaagccgtccaactttcaagcgatatattcgaatgatcagtggatattacctggct
gcgcgtcaattggaatttttggtgggtagaagttccttaggattgtttacttctagcttg
gaagatccactggggattgcccaacatcatgatgcagtctcaggaacggcaaagcaacac
acaactgatgattattcgaaacgccttgcgattggggtttctcaggttgagaaaggtgtt
aatactgctctaagttgtctcacaagttccaaaggaacatgtacagcaacaaaatttagt
cagtgccaacttctcaatattagctactgcccttcaactgaggaaggaatttcatccgca
aagagtttagttatagttgtttataatcctcttggatgggaacgtagtgactttgtaaga
gttccagtaaatgatgccaacttaattgtaaaaacctctgatggaacttctctggagtca
caactagttgaagttgatatcgtgacagcacgtttaaggaagttatacataaaggcttat
cttggaatcacgtccgataaacccccaaagtattggctagtttttcaagcttctgtacca
ccactcggctggaacacctacttcatatcaaaatctactggaacaggatctaatggaatg
gggtatgtctcaaccatggtttctccaagtaatgacacaatagaaattggaccagggcct
ctgaagatgtcctattcatcaaaatctggacaactcaagagaatgttcaattctatctct
gcagtggatttgccaattcaacagagctttctttggtatgcttcaagcacgggagattct
gaagattcacaggcatccggagcatatattttcagaccaaataggactacaccgactata
gtttcaggaatggcgccattgaaagttatccatggacctcttgttgacgaagtccaccaa
cagttcagctcatggatttatcaggtcacgagactctacaagaataaggagcacgctgaa
gttgaatatactattggaccaatacctgttgatgatgatgatgacataggaaaggaggtt
gttaccagactgacaacaaatatggccaccaacaaaatattttatacagattctaatgga
agagatttcctcgaaagggtgagaaaccacagggatgattgggaccttaatttgtctcaa
cctgttgcaggaaattactacccggtcaatcaaggaatatatgtagcagatgggaaatat
gaactatctgtccttgtggatcatgctgttggagcttcgagtattcaagatggtcagatt
gaagttatgctccacaggcgtctttctgcagacgatggcagaggagttggggaaccactt
aatgaagtagtatgtgtggatcaaaagtgcgatgggctagtggccagggcaacttactat
atcaatgtcaataagaaaggacatggagctcattggcgccgaacatatagccaacaagtt
tattcaccgttccttgttgcttttgcacatgaggacgaacgcagttggaaatccaacaat
attgcaaaagcaagtacggtagaaggaaactatagtcttcctgataatgttgcaatcatc
accttgcagagtcttgatgatggcaccacactccttcgattggcgcatctttttcaggct
caagaggacacacaatattcagtaatggcaaaggttgaattgagaaagctgtttggaaag
aggataatcaaagatttgactgagactagcctatctgcaaaccaaaagaagtcagagatg
aagaagctcaattggagagtaaccggggagagcaaaactgatcctgcaccattgaagggt
ggcccagttgacagccacgcccttgttgttgagcttggaccgatggagatacgcacattc
ttgctgaaattctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350617
Entry
4350617           CDS       T01015                                 
Name
(RefSeq) alpha-mannosidase isoform X1
  KO
K01191  alpha-mannosidase [EC:3.2.1.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4350617
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4350617
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     4350617
Membrane trafficking [BR:osa04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Selective cargos
    4350617
SSDB
Motif
Pfam: Glyco_hydro_38N Glyco_hydro_38C Alpha-mann_mid Glyco_hydro38C2
Other DBs
NCBI-GeneID: 4350617
NCBI-ProteinID: XP_015617007
UniProt: Q2R3E0 B9GAZ2
LinkDB
Position
11:19058355..19067601
AA seq 1020 aa
MGASAARLAALLLLLLAAAAAVGECVYIPYNTSAGVVGGKLNVHVVPHTHDDVGWLKTVD
QYYVGSNNSIQGACVQNVLDSLVPALLKDENRKFVYVEQAFFQRWWRQQSDMIKDIVKGL
ISTGRLELINGGMCMHDEATVHYIDMIDQTTLGHRFIKEEFGQIPRIGWQIDPFGHSAVQ
AYLLGTEVGFDAFYFFRIDYQDRDTRKGTKELEVVWRGSKTFGSSADIFAGIFPKNYEPP
PGQFYFEVDDTSPIVQDDPLLFDYNVEQRVDDFVAAAIAQANITRTNHVMFTMGTDFKYQ
YAESWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKHAENVPWPLKTNDFFPYADNPNAY
WTGYFTSRPALKRYVRVMSGYYLAARQLEFFKGRSNSDLTTDSLADALALAQHHDAVTGT
EKQHVANDYAKRLSIGYTQAEKLVSSSLSCLSQSGSKSHCPSQTTNFEQCPLLNITYCPP
SEMDLSQGKSLVVLVYNSLGWKREDVLRIPVISDSIVVHDSEGREVESQLLPIANASLYM
REKHVKAYLGMLPAAKPKFWLAFPVSVPPLGFNTYFISSGKKSASVSLMSTLHSSQGSEN
SNMQIGQGQLKLQYNAAGALSLYSNSKTQVEANFEQKYKYYIGQDGNGSDPQASGAYIFR
PNGTVPIKTDGQVPLTVLRGSILDEVHQQINPWIYQINRVYKGKDYVETEFIVGPIPVDD
GNGKELSTEVVTNMATNKTFYTDSSGRDFIKRIRDYRSEWKIEVHQPIAGNYYPVNLGIY
VEDGSRELSILVDRSVGGASIKDGQIELMLHRRLLHDDGRGVAEALNETTCFDNQCEGLV
IQGKYYLKIDPQGEGARWRRTFGQEIYSPLLIAFAEQDGGNWVNSHVTKFSAMDPAYSLP
DNVALLTLQELEDGTVLLRLAHLYEAGEHKDLSALASVDLKRVFPDKKIVKIVETSLSAN
QERSAMEKKRLKWKVEGPPADEKIVRGGPVDPSKLVVDLGPMEIRTFLINFAPQSGKQLM
NT seq 3063 nt   +upstreamnt  +downstreamnt
atgggcgcctccgccgcccgcctcgcggcgctgctcctgctcctcctcgccgccgccgct
gccgtcggggagtgcgtgtacatcccctacaacacgtcggcgggggtggtgggggggaag
ctcaacgtgcacgtggtgccgcacacccacgacgacgtcgggtggctcaagaccgtcgac
cagtactacgtcggatccaacaactccatccagggggcgtgcgtgcagaatgtgctggat
tcgctcgtgccagcgctgctcaaggatgagaaccgcaagttcgtctatgttgagcaggca
ttcttccagagatggtggagacagcagagcgacatgattaaggatatagtgaaggggctc
atcagcactggacgattggaattaataaacgggggaatgtgcatgcatgatgaagcgacc
gtgcactacattgacatgatagaccagactacgctcgggcacaggttcatcaaggaggag
tttggtcagattccaaggattggttggcagattgatccgtttgggcactccgcagttcag
gcttacctcctaggcacagaagtaggattcgatgctttttattttttccggattgattac
caagaccgtgacacacggaagggaacaaaagagctcgaggttgtgtggaggggctccaag
accttcggctcatcagctgacatctttgctggcatcttcccaaaaaattatgaaccacct
cctggtcagttttacttcgaagttgatgatacttccccaatcgtccaggatgatcccctt
ctttttgattataatgtggagcaacgggtggatgactttgttgctgcagctatagcacag
gcaaatattacaaggacaaatcacgttatgtttacaatgggcacagacttcaaatatcaa
tatgcagaaagttggttcagacagatggacaaattaattcactacgttaataaggatggc
cgtgtcaatgctctgtattccacaccttcgatttatactgatgcaaaacatgctgaaaat
gtgccatggcctctcaagactaatgattttttcccgtatgcagacaacccaaatgcatat
tggacaggttacttcacaagcagacctgccttaaaacgatacgttcgtgttatgagtgga
tattacttggcagctaggcagttggaattctttaaagggagaagcaactctgatctcaca
acagatagtttagctgatgctctagctcttgctcagcaccatgatgctgttacaggaacg
gagaagcaacatgtcgcaaatgactatgcaaagagattatcaattggctatacacaagcc
gagaagctggtttcatcctctctctcttgcttgagccagtcaggctcaaaatcacattgt
ccgtcccaaacaacgaattttgaacagtgtccgctcctaaatattacatattgcccccct
tccgagatggacctttctcaagggaaaagtttggttgtgcttgtgtacaactctcttggg
tggaaacgggaggatgtccttcgcataccggtcatcagtgactcaattgttgttcatgat
tctgagggaagagaagttgaatcacaacttctgcctatagctaatgcatctttgtacatg
cgggagaaacatgtcaaggcttacctaggcatgttaccagctgcaaaacccaagttttgg
cttgcttttccagtttctgtaccacctcttggtttcaatacgtactttatatcaagcggg
aagaaatcagcatcagtctctttgatgtccactctgcactcatctcaaggaagtgaaaat
agtaacatgcaaattgggcaaggacagttgaaacttcaatacaatgcagctggagcatta
tctctgtactccaatagtaagacccaggttgaagcaaattttgagcagaagtacaagtat
tacataggacaggatggaaatggaagtgatcctcaggcttctggagcatacatatttcgc
cctaatggcacagttcctatcaagactgatggacaggttcctctgacagttctccgtggg
tccatattggacgaagtgcatcagcagattaatccatggatatatcagatcaacagagtt
tacaaaggaaaggactatgtggagactgaatttatagttggaccaataccagtggatgat
ggaaatggaaaagaactatccactgaagtcgttacaaacatggcaacaaacaaaacattt
tacactgattccagtggacgtgacttcatcaaaaggatacgggattaccggtcagagtgg
aagatcgaagtgcaccagcctatcgctggaaactattatcctgttaatcttggcatttat
gtggaagatggaagcagagagttatctatacttgtagacaggtctgttggaggtgccagc
ataaaggatggacagatagagctaatgctacacaggagactacttcatgatgatggtcgt
ggtgttgcagaggcattaaatgaaacaacctgttttgataatcaatgtgaaggactagtt
attcaaggaaagtattatctcaaaattgatccacaaggtgaaggagctaggtggcggcgg
acatttggccaggaaatatactcccctcttcttattgcttttgcagagcaggatggaggt
aattgggtgaattcacacgttacaaaattctctgcaatggatccggcctacagcttgcct
gataatgttgcattgcttactcttcaggaacttgaagacggaactgttcttcttcggttg
gctcacctatacgaggctggagagcacaaggatctttcagctctagctagcgtcgacctg
aagagagtatttccagacaagaagattgtcaagattgttgagacaagcctatcagcgaac
caagaacgttcagccatggagaaaaagaggctgaagtggaaggtggaaggccctcctgct
gatgaaaagatcgtccggggaggccccgtagatccttccaagctcgtcgttgatctgggc
cccatggagatacgcacattcctcatcaatttcgccccgcagtccggcaaacagttgatg
tga

DBGET integrated database retrieval system