KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348555
Entry
4348555           CDS       T01015                                 
Name
(RefSeq) delta(24)-sterol reductase
  KO
K09828  Delta24-sterol reductase [EC:1.3.1.72 1.3.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    4348555
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.72  Delta24-sterol reductase
     4348555
    1.3.1.-
     4348555
SSDB
Motif
Pfam: FAD_binding_4 DUF3721 DUF5623
Other DBs
NCBI-GeneID: 4348555
NCBI-ProteinID: XP_015614442
UniProt: Q8RU48 A0A8J8XJU4
LinkDB
Position
10:complement(13359607..13363111)
AA seq 561 aa
MADLQEPLVRPKRKKVLVDYLVKFRWILVIFVVLPISALIYFNIYLGDVWSAMKSEKRRQ
KEHDDNVQKVVKRLKQRNPKKDGLVCTARKPWIAVGMRNVDYKRARHFEVDLSAFRNILE
IDRERMVAKVEPLVNMGQITRATCPMNLALAVVAELDDLTVGGLINGYGIEGSSHLYGLF
SDTVVAVEVVLADGRVVRATKDNEYSDLFYGIPWSQGTLGFLVSAEIKLIPIKEYMRLTY
TPVKGSLKEIAQGYCDSFAPRDGDPAKVPDFVEGMVYTENEGVMMTGVYASKEEAKKKGN
KINCVGWWFKPWFYQHAQTALKKGEFVEYIPTREYYHRHTRCLYWEGKLILPFGDQFWFR
FLLGWLMPPKVSLLKATQGESIRNYYHDNHVIQDMLVPLYKVGDALEFVHKEMEVYPLWL
CPHRLYKLPVKTMVYPEPGFEHHHRQGDTSYAQMFTDVGVYYAPGAVLRGEEFNGALAVH
RLEQWLIENHSYQPQYAVSELNEKDFWRMFDASHYEHCRQKYGAVGTFMSVYYKSKKGRK
TEKEVQEAEAAILEPAYADEA
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggcagatctgcaggagcccctcgttcgtccgaagaggaagaaggttttggtggactac
ttggtaaagttccgatggattctggtgatctttgtggtgctccccatttccgctctgatc
tacttcaatatctatttgggcgatgtctggtctgccatgaaatctgagaaacgtcgccag
aaggaacatgatgacaatgtgcaaaaagttgtgaagcggctcaagcagaggaacccaaag
aaggatggccttgtttgcacagctaggaagccctggattgctgttggcatgcgcaatgta
gactacaagcgtgctaggcattttgaggttgacctttccgccttcaggaacattcttgag
attgacagagagagaatggttgccaaggttgagcctcttgtcaacatgggccagataacc
agagctacatgcccaatgaaccttgcccttgcagttgttgctgagcttgatgaccttact
gttgggggactgatcaatgggtatggtattgaagggagctctcacctctatggtcttttc
tctgacactgttgtcgccgtggaagttgttcttgcagacggtcgagttgttagagccact
aaggataatgagtactctgaccttttctatggcattccctggtcccagggaacacttggg
tttcttgtttccgctgagatcaaactcattcccatcaaggaatacatgaggctcacatat
actccagttaaagggtcactgaaggagatagcacaaggttattgtgattcgtttgcacca
cgagatggtgatcctgcaaaggtcccagacttcgttgagggaatggtgtacacagaaaat
gagggtgtcatgatgactggtgtttatgcttccaaagaagaggcaaagaagaagggcaat
aagatcaactgtgtcgggtggtggttcaagccttggttttaccaacatgctcagacagca
ctcaagaagggtgagtttgtggagtacattccaacaagagagtactaccaccgtcacacc
cggtgtctgtactgggaggggaagctgatcttgccattcggcgaccaattctggttcagg
ttcctcttgggctggctgatgccaccaaaggtgtctctgctcaaggccacacagggtgaa
tctatcaggaattactaccatgacaaccatgtgattcaagacatgctggttcccttgtac
aaagttggagatgctcttgagtttgttcacaaggaaatggaggtttatccactgtggctg
tgcccgcaccggctctacaagctccctgtgaaaaccatggtgtacccagagcctggcttt
gagcaccaccacaggcaaggtgacactagctatgcccagatgttcaccgatgttggtgtg
tactatgctcctggtgctgtcctgaggggcgaggagttcaatggcgctctagctgtccac
aggctggagcagtggctgattgagaaccacagctaccagccacagtacgctgtatctgag
ctcaacgagaaggacttctggaggatgtttgatgcttctcactacgagcattgccgccaa
aagtatggtgccgtcggtacctttatgagcgtctactacaagtccaagaagggaaggaag
actgagaaggaggtgcaggaagccgaggccgccatcctcgagccagcctacgctgatgag
gcgtaa

DBGET integrated database retrieval system