KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348636
Entry
4348636           CDS       T01015                                 
Name
(RefSeq) GDP-mannose 3,5-epimerase 1
  KO
K10046  GDP-D-mannose 3', 5'-epimerase [EC:5.1.3.18 5.1.3.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00114  Ascorbate biosynthesis, plants, fructose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4348636
   00520 Amino sugar and nucleotide sugar metabolism
    4348636
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.18  GDP-mannose 3,5-epimerase
     4348636
    5.1.3.-
     4348636
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 NAD_binding_10 Polysacc_synt_2 RmlD_sub_bind NmrA adh_short
Other DBs
NCBI-GeneID: 4348636
NCBI-ProteinID: XP_015614669
UniProt: A3C4S4
LinkDB
Position
10:14639995..14643340
AA seq 378 aa
MGSSEKNGTAYGEYTYAELEREQYWPSEKLRISITGAGGFIGSHIARRLKSEGHYIIASD
WKKNEHMTEDMFCHEFHLVDLRVMDNCLKVTNGVDHVFNLAADMGGMGFIQSNHSVIMYN
NTMISFNMLEAARINGVKRFFYASSACIYPEFKQLETNVSLKESDAWPAEPQDAYGLEKL
ATEELCKHYTKDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKAQTSTDRFEMWGDG
LQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIILSFEDRELPIHHIPG
PEGVRGRNSDNTLIKEKLGWAPTMKLKDGLRFTYFWIKEQIEKEKTQGVDIAGYGSSKVV
STQAPVQLGSLRAADGKE
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggggagctcggagaagaacggaactgcttatggcgagtacacctatgctgaactggag
agggagcagtactggccgtctgagaagctgaggatatcgatcaccggagctggtggtttc
attggatcccacattgctcgccgtctgaagagcgaggggcattacatcatcgcctccgac
tggaagaagaatgagcacatgactgaggacatgttctgccatgagttccaccttgttgac
cttagggtcatggacaactgcctcaaggtcaccaacggcgtcgaccatgtgttcaacctt
gccgctgatatgggtggtatggggttcattcagtccaaccactctgtgatcatgtacaac
aacaccatgatcagtttcaacatgctcgaggctgcacgtatcaatggtgtgaagaggttc
ttctatgcctcaagtgcatgcatttaccctgaattcaagcagcttgaaactaacgttagc
ctgaaggaatctgatgcctggcctgctgagcctcaagatgcctatggtttggagaagctt
gcaactgaggagctctgcaagcactacaccaaggactttggcattgagtgccgtgttggc
cgcttccacaacatatatggcccctttggaacatggaaaggtggccgtgagaaggcacca
gctgcattctgcaggaaggctcagacttccactgacaggtttgagatgtggggtgatggc
ctccagacccggtccttcacattcatagatgagtgtgttgagggtgttctgaggttgaca
aagtcggacttccgtgagccagtgaacattggaagcgatgaaatggtaagcatgaacgag
atggctgaaatcattctcagcttcgaggatagggagctgcccatccaccacatccctgga
cccgagggtgtccgtggccgtaactccgacaacaccctcatcaaggagaagcttggctgg
gcacccacaatgaagctcaaggacgggctgaggttcacctacttctggatcaaggagcag
atagagaaggagaagacccagggcgtcgacatcgcgggttacggctcatccaaggtggtg
tccacccaggccccggttcagctgggctccctccgtgctgccgatggcaaggagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350816
Entry
4350816           CDS       T01015                                 
Name
(RefSeq) GDP-mannose 3,5-epimerase 2
  KO
K10046  GDP-D-mannose 3', 5'-epimerase [EC:5.1.3.18 5.1.3.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00114  Ascorbate biosynthesis, plants, fructose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4350816
   00520 Amino sugar and nucleotide sugar metabolism
    4350816
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.18  GDP-mannose 3,5-epimerase
     4350816
    5.1.3.-
     4350816
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 NAD_binding_10 Polysacc_synt_2 RmlD_sub_bind
Other DBs
NCBI-GeneID: 4350816
NCBI-ProteinID: XP_015617577
UniProt: Q2R1V8
LinkDB
Position
11:complement(22459958..22464764)
AA seq 371 aa
MALNEEYTYVELEKEPYWPFEKLRISITGAGGFIASHIARRLKSEGHYIIASDWKKNEHM
TEDMFCHEFHLVDLRVMDNCLKVTTGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFN
MLEAARINGVKRFFYASSACIYPEFKQLDTVVSLKESDAWPAEPQDAYGLEKLATEELCK
HYTKDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKALTSTDRFEMWGDGLQTRSFT
FIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFENKQLPIHHIPGPEGVRGR
NSDNTLIKEKLGWAPTMRLKDGLRITYFWIKEQLEKEKAEGVDLSAYGSSKVVQTQAPVQ
LGSLRAADGKE
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcgctcaatgaggagtacacatacgtggagctggagaaggagccttactggccattt
gagaagctgcggatctcgattacgggagctggcgggttcatcgcatcccacatcgcgagg
cgcctcaagagcgagggccactacatcattgcttctgactggaagaaaaatgagcacatg
actgaggatatgttctgccatgagttccatcttgttgatttgagggtgatggacaactgc
ctcaaggtgaccaccggggttgaccatgttttcaaccttgccgctgatatgggagggatg
ggattcattcaatccaatcactctgttatcatgtacaacaacaccatgatcagctttaac
atgcttgaggccgctaggattaatggtgtcaaaaggttcttttatgcttcaagtgcttgt
atctaccctgaatttaagcagctggacactgtagttagcttgaaggagtcagatgcttgg
cctgcagagcctcaagatgcctatggcttggaaaaacttgctactgaggaactgtgcaag
cattacacaaaggattttggcattgaatgtcgggttggccgctttcataatatctatggt
ccctttggaacatggaagggtggaagggagaaggcgcctgctgctttctgcagaaaagct
ctaacctccactgaccgttttgagatgtggggagatggtcttcagactagatccttcacg
tttattgatgaatgtgtggagggtgtcctcaggttgacaaagtccgatttccgtgagcct
gtaaacattggaagtgatgaaatggtcagcatgaatgagatggctgagatagtcctcagc
tttgagaacaagcagctgcccatccaccacatccccgggccagagggtgtccgtggtcgc
aactccgacaacacgctcatcaaagagaagcttggctgggctccaaccatgaggctgaag
gatggtctgaggatcacatacttctggatcaaggagcagctcgagaaggagaaggccgag
ggcgtcgacttgtcggcctacgggtcatccaaggtagtgcagactcaggcgccggtgcag
cttggctccctccgtgctgctgatggaaaggagtga

DBGET integrated database retrieval system