KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348949
Entry
4348949           CDS       T01015                                 
Name
(RefSeq) thioredoxin-like protein YLS8
  KO
K12859  U5 snRNP protein, DIM1 family
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4348949
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4348949
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    4348949
SSDB
Motif
Pfam: DIM1 Thioredoxin Thioredoxin_7 Thioredoxin_8 DUF3192
Other DBs
NCBI-GeneID: 4348949
NCBI-ProteinID: XP_015612821
UniProt: Q7F0N0 Q7X873
LinkDB
Position
10:18411495..18414230
AA seq 142 aa
MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLAAVAETIKNFAVIYL
VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
RGARKGRGLVIAPKDYSTKYRY
NT seq 429 nt   +upstreamnt  +downstreamnt
atgtcgtaccttctgccgcatctgcactcggggtgggcggtggaccaggccatcctcgcg
gaggaggagcgcctcgtcatcatccgcttcggccacgactgggacgagacgtgcatgcag
atggatgaggtgctagcggcagtagctgagaccataaagaactttgcggtcatctacctg
gtcgacatcaccgaggttccagacttcaacaccatgtacgagctgtatgatccgtcgacg
gtgatgttcttcttccgcaacaagcacatcatgattgatctggggacaggaaacaacaac
aagatcaactgggccttgaaggacaagcaggagttcatcgacattgtggagaccgtctac
agaggtgctcgcaaagggcgtggtttggtgattgctcccaaggactactccactaaatac
cgttactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268087
Entry
9268087           CDS       T01015                                 
Name
(RefSeq) thioredoxin-like protein YLS8
  KO
K12859  U5 snRNP protein, DIM1 family
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    9268087
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    9268087
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    9268087
SSDB
Motif
Pfam: DIM1 Thioredoxin Thioredoxin_7 Thioredoxin_8 DUF3192
Other DBs
NCBI-GeneID: 9268087
NCBI-ProteinID: XP_015646995
UniProt: Q7F0N0 Q7X873
LinkDB
Position
7:complement(5508050..5510790)
AA seq 142 aa
MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLAAVAETIKNFAVIYL
VDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY
RGARKGRGLVIAPKDYSTKYRY
NT seq 429 nt   +upstreamnt  +downstreamnt
atgtcgtacctgctgccgcacctgcactccgggtgggcggtagaccaggccatcctcgcc
gaggaggagcgcctcgtcatcatccgcttcggccacgactgggacgagacctgcatgcag
atggatgaggtgttggcagcagtggctgagaccataaagaacttcgcggtcatctacctg
gttgacatcactgaggttcctgacttcaacaccatgtacgagctgtatgatccatcaaca
gtcatgttctttttccgaaacaagcacatcatgattgatcttgggactggaaacaacaac
aaaatcaactgggccctgaaggacaagcaggagttcatcgacattgtggagactgtctac
aggggtgctcggaaggggcggggtctggtgatcgctccaaaggattactccacgaaatac
cgttattga

DBGET integrated database retrieval system