KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349020
Entry
4349020           CDS       T01015                                 
Name
(RefSeq) protein STABILIZED1
  KO
K12855  pre-mRNA-processing factor 6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4349020
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4349020
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    4349020
 Complex C
   U5 SnRNP specific factors
    4349020
SSDB
Motif
Pfam: PRP1_N TPR_14 TPR_19 TPR_2 TPR_16 NatA_aux_su TPR_1 Sde2_N_Ubi PMC2NT
Other DBs
NCBI-GeneID: 4349020
NCBI-ProteinID: XP_015613825
UniProt: Q8W3F7 A0A5S6R9Z8
LinkDB
Position
10:complement(19009700..19014290)
AA seq 1039 aa
MVFVRAPDGRTHHVDLDPSTATLADLTASASRVCGGVPPEQLRLYLAHRRLLPAEPSPLL
SSLRVSASSSLLLHLPLLGGMTGPTTTPAAPPPPPPPSAQPPARPARYDFLNSKPPPNYV
AGLGRGATGFTTRSDIGPARAAPDLPDRSAAAAAAPAVGRGRGKPPGDDDGDDDGGDEEK
GYDENQKFDEFEGNDAGLFSNADYDDDDREADAVWESIDQRMDSRRKDRREARLKQEIEK
YRASNPKITEQFADLKRKLVDLSAQEWESIPEIGDYSLRNKKKRFESFVPVPDTLLEKAR
QEQEHVTALDPKSRAAGGTETPWAQTPVTDLTAVGEGRGTVLSLKLDRLSDSVSGLTVVD
PKGYLTDLKSMKITSDAEISDIKKARLLLKSVTQTNPKHPPGWIAAARLEEVAGKLQVAR
QLIQRGCEECPTNEDVWVEACRLASPDEAKAVIARGVKAIPNSVKLWLQAAKLETSDLNK
SRVLRKGLEHIPDSVRLWKAVVELANEEDARLLLHRAVECCPLHVELWLALARLETYDQA
KKVLNKAREKLPKEPAIWITAAKLEEANGNTQSVIKVIERSIKTLQREGLDIDREAWLKE
AEAAERAGSVLTCQAIVKSTIGIGVDEEDRKRTWVADAEECKKRGSIETARAIYAHALSV
FVSKKSIWLKAAQLEKSHGTKESLYNLLRKAVTYNPRAEVLWLMSAKEKWLAGDVPAARA
ILQEAYASLPNSEEIWLAAFKLEFENNEPERARILLSKARERGGTERVWMKSAIVERELG
NVDEERKLLEEGLKLFPSFFKLWLMLGQMEDRLGHGSKAKEVYENALKHCPSCIPLWLSL
ANLEEKINGLSKSRAVLTMARKKNPATPELWLAAVRAELRHGNKKEADALLAKALQECPT
SGILWAAAIEMVPRPQRKAKSSDAIKRCDHDPHVIAAVAKLFWHDRKVDKARSWLNRAVT
LAPDIGDFWALYYKFELQHGNADTQKDVLQRCVAAEPKHGERWQAITKAVENSHLSIEAL
LKKAVLALGQEENPNAADP
NT seq 3120 nt   +upstreamnt  +downstreamnt
atggtgttcgtccgcgcgccggacgggaggacccaccacgtcgacctcgacccctccacc
gccacgctcgccgacctcacggcctccgcctcccgcgtctgcggcggcgtcccgccggag
cagctgcggctctacctcgcccaccgccgcctcctcccggccgagccgtccccgctgctg
tcctccctccgggtctcggcctcctcctccctgctactccacctccccctgctcggaggg
atgaccggcccgacgacgacccccgcggcacccccgcccccgccgccgccgtcggcgcag
ccgcccgcccgccccgcgcgctacgacttcctcaactccaagccgcccccgaactacgtg
gccggtctggggcgtggcgccaccgggttcaccacccgttcggatatcgggccggcccgc
gcggcgcccgatctgcctgaccggtccgccgccgccgccgccgcccccgccgtcgggcgc
ggccgtgggaagccacccggggacgacgacggcgacgacgatggcggcgacgaggagaag
gggtacgacgagaaccagaagttcgacgagttcgagggcaacgacgccgggctgttctcc
aacgccgactacgacgacgacgaccgcgaggcggatgcggtctgggagagcatcgaccag
aggatggactctcgccggaaggatcggcgggaggcgcggctgaagcaggagatcgagaag
taccgtgcttccaaccctaagatcaccgagcaattcgctgatttgaagcgtaagttggtc
gatttgtcggcgcaggagtgggaaagcatacctgaaattggggactactcgctgcgcaac
aagaagaagcgatttgagagcttcgttcccgtgccggacaccctgctcgagaaggctcgg
caggagcaggagcatgtcacggcactggatcccaagagccgtgcagctggtggcaccgag
acgccatgggcgcagactccggttaccgatctgacggctgtgggcgaaggtcgtggcacc
gtgctctccttgaagctggacaggttgtcggattcggtatctggtcttactgttgttgat
ccaaagggttacttgacggacctgaaaagtatgaagattactagtgatgctgagatttct
gacattaaaaaggcgcgattgttgcttaagtcagtgacacagacaaacccgaagcatcca
ccaggatggattgctgctgctaggcttgaagaggttgctggcaagcttcaggttgctcgg
cagcttatccagcgtggctgtgaggagtgccccacaaatgaggatgtttgggtcgaggca
tgccggctggccagcccagacgaggcaaaggcagtgattgctaggggcgtgaaggcaatt
cccaattctgtgaagctgtggttgcaggcagcaaagttggaaactagtgatttgaataag
agcagggttttgagaaaagggttggaacacattcctgattcagtcagactgtggaaagca
gtagtagagcttgcaaatgaggaggatgcaagactgttgcttcacagggctgtggagtgc
tgcccactccatgtggaactgtggcttgccctagcaaggctggagacatatgaccaagca
aagaaggtacttaacaaggcaagagaaaagcttcctaaggaacctgccatctggattaca
gctgcaaagctggaggaagctaatggaaacacccagtcagtaatcaaggtgattgagaga
agtataaaaactttacagagagaaggattggatattgacagggaggcatggctaaaggaa
gcagaagctgctgagcgtgctggatctgtattgacttgccaggctattgttaagagcact
attggcattggtgttgatgaggaagacagaaaacgcacatgggttgccgatgctgaggaa
tgcaagaagcgtggttcaattgagacagcccgtgccatctatgcgcatgcactcagtgtc
ttcgtttccaagaagagtatttggctgaaagcggctcagcttgagaagagccatggaacc
aaggagtctctttataatctcctcagaaaggctgttacctacaatccacgtgcagaagtt
ttatggcttatgagtgcaaaggagaaatggctggctggagatgtcccggctgcccgagcc
attcttcaggaagcttatgcttctctccccaattcagaggagatctggctagctgccttc
aagcttgagtttgagaacaatgaaccagagagagcaagaattcttttgtcaaaggccagg
gaaagaggaggcactgagagggtctggatgaaatctgcgattgttgaaagggagttaggg
aatgtagacgaagaaaggaagctgttggaggaaggtctgaagttattcccctcattcttc
aagctgtggttaatgcttggacaaatggaagaccggcttggccatggatccaaggcaaag
gaggtttacgagaatgcactgaagcactgcccgagttgcatccctctttggctctctcta
gctaatctagaggagaagataaatggcttgagcaagtcacgtgctgtcctcaccatggca
agaaagaagaacccagctacacctgaactctggcttgcagcagttagggctgaattgaga
catgggaacaagaaggaagctgatgctctactagccaaggcattacaggaatgcccgaca
agtggtattttgtgggctgcagctatagagatggtgccacgtccccagcgtaaagcaaag
agctcagatgctataaaacgatgtgaccatgatccccatgtcattgcagctgtggccaaa
cttttctggcatgataggaaggttgataaagctagaagttggttgaatagagctgttact
cttgctccagacattggagatttttgggccttgtactacaaatttgaactgcaacatgga
aatgctgatacacaaaaggatgtcctacaaagatgtgttgcagcagaaccaaagcatgga
gagagatggcaagcaataacaaaggctgttgagaactcacatctgtcaattgaggccctt
ctgaagaaagctgtgttggctcttggccaggaagaaaatccaaatgctgcagatccctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270118
Entry
9270118           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: protein STABILIZED1
  KO
K12855  pre-mRNA-processing factor 6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    9270118
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    9270118
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    9270118
 Complex C
   U5 SnRNP specific factors
    9270118
SSDB
Motif
Pfam: PRP1_N TPR_14 TPR_19 TPR_16 TPR_2 TPR_1 PMC2NT
Other DBs
NCBI-GeneID: 9270118
NCBI-ProteinID: XP_015618255
LinkDB
Position
1:8931335..8948833
AA seq 936 aa
MASPTATTPSAPPPPPPPPAACAARYDFLNSKPPPNYVARLGRGAAGFTTRSDIGPAMGR
GRGKPPGDDGDGDGGGDEEEKGYDENQKFDEFEGNDAGLFSNAGHDDDDDDREADAVWEG
IDRRMDSRRKDWREARLKQEIERYRASNPKITEQFADLKRKLVDLSAQEWESIPEIGDYS
LRRNKKRRFESFVPVPDTLLEKARQEQGHVTALDPKSRAAAAGAETPWAQTPVTDLTAVG
EGRGTVLSLKLDRLSDSVSGVTIVDPRGYLTNLKSMKITSDAEISDIKKARLLLKSVIQT
NPKHPPGWIAAARLEEVAGKLQVAQQLIQRGCEECPTNEDVWLKACRLASPDEAKAVIAR
GVKEIPNSVKLWLQAAKLETSDLNKSRVLRKGLEHIPDSVRLWKSVVELANEEDARLLLH
RAVECCPFHLELWLALARLETYDQAKKVLNKAKEKLPKEPAIWIMAAKLEEANGNTESVN
EVIERSIKTLQGKGLGIDREAWLKEAEAAEHAGSVMTCQAIVKNTIGVGVDDEDRKRTWV
ADAEECKKRGSVETAPAIYAHVLSVFKFKKSIWLKAAQLEKRHGTEESLYILLSKATTYN
RHAEVLWLMYAKEKWLAGDVPAAQTILQEAYAYLPNSEEIWLAAFKLEFENNEPERARIL
LSKARERGGTERVWMKSAIVERELGNVDEERKLLEEGLKLFPSFFKLWLMLGQMEDRLGH
VAKAKEANENALKHCPNXNLEEKINGLRKSRAVLTMARKKNPATPELWLAAVRAELRHRN
KKEADALLAKALQECPTSGILWAAAIEMVPRPQRKAKSSDAIKRCDHDPHVIAAVAKLFW
HDRKFDKARSWLNRAVTLAPDIGDFWALYYKFELQHGNADTHKDVVQRCVASEPKHGERW
QAIAKAVENSHLSIEALLKKAVVALGQDENPNAVDP
NT seq 2811 nt   +upstreamnt  +downstreamnt
atggcctccccgaccgcgaccaccccctcggcgcctccgccaccaccaccgccacccgca
gcctgcgccgcgcgctacgacttcctcaactccaagccgccccccaactacgtggcgaga
ctgggacgcggcgccgccgggttcaccacccgctcggatatcgggcccgccatggggcgc
ggccgtgggaagccgcctggggacgacggcgacggcgatggcggtggcgacgaggaggag
aaggggtacgacgagaaccagaagttcgacgagttcgagggcaacgacgccggcctcttc
tccaacgccggccacgacgacgacgacgacgaccgcgaggcggacgcggtctgggagggc
atcgaccggaggatggactcgcgccgcaaggactggcgagaggcgcggctgaagcaggag
atcgagaggtaccgcgcgtccaaccctaaaatcaccgagcaattcgccgatctgaagcgg
aaattggtcgatttgtcagcgcaggagtgggagagcataccggagattggggattattcg
cttcgtcgcaacaagaagaggcgatttgagagctttgtcccggtgcctgacaccctgctc
gagaaggcccggcaggagcaggggcatgtcaccgcattggaccccaagagccgtgcagcc
gccgctggcgcagagacgccatgggcgcagactccggttactgatctgacagccgtcggc
gaaggccgtggcaccgtgctttctttgaagctggacaggttatccgattcggtatccggt
gttactattgttgatccaaggggttacctgactaacctgaagagtatgaagattactagt
gatgctgaaatttctgacataaagaaggccaggttgttgctcaagtcagtgatacagacg
aacccaaagcatccaccaggatggattgctgctgctaggcttgaagaggttgccggcaag
cttcaggttgctcagcagctcatccagcgtggctgcgaggagtgccccacgaatgaggat
gtttggctcaaggcatgccggttggccagcccagatgaggcaaaggccgtgattgccagg
ggtgtgaaggaaattcccaattctgtgaagctgtggttgcaggcagcgaagttggaaact
agtgacttgaataagagcagggttttgagaaaagggttggaacacattcctgattcagtc
aggctgtggaaatcagtagtagagcttgcaaatgaggaggatgcaaggctgttgcttcac
agggctgtggagtgctgcccattccatttggaactgtggcttgcactagcgaggctggag
acgtatgaccaagcaaagaaggtacttaacaaggcaaaagaaaagctccctaaggagcct
gccatctggattatggctgcaaagctggaggaagctaatggaaacaccgagtcagtaaac
gaggtgattgagagaagtataaaaactttacagggaaaaggattgggtattgacagggag
gcatggctaaaggaagcagaagctgctgagcatgctggatctgtgatgacttgccaggct
attgtgaagaacactattggcgttggtgttgatgatgaagacagaaaacgcacatgggtt
gctgatgctgaggaatgcaagaagcgtggttcagttgagacagcccctgccatctatgca
catgtgctcagtgtcttcaaattcaagaagagtatttggttgaaagcggctcagcttgag
aagagacatgggactgaggagtctctttatattctcctcagtaaggctacaacatacaat
cgacatgcagaagtgctatggcttatgtatgcaaaggagaaatggctggctggagatgtc
cctgctgcccaaaccattcttcaggaagcttacgcttatcttcccaattcagaggagatc
tggctagctgccttcaagcttgagtttgagaacaatgaaccagagagagcaagaattctt
ttgtcaaaggccagggaaagaggaggcactgagagggtctggatgaaatctgccattgtt
gaaagggagttagggaatgtagacgaggaaagaaagctgttggaggaaggtctgaagtta
ttcccctcattcttcaaattgtggttaatgcttgggcaaatggaagaccggcttggtcat
gtagccaaggcaaaggaggctaatgagaacgcactgaaacactgcccgaacnntaatcta
gaggagaagataaatggcttgaggaagtcacgtgctgttctcaccatggcaagaaagaag
aacccagctacacctgaactctggcttgcagcagttcgagctgaattgaggcataggaac
aagaaggaagctgatgctttactagccaaggcattgcaggagtgcccaacaagtggtatc
ttgtgggctgcagctatagagatggtgccacgtccccaacgtaaagcaaagagctcggat
gctataaaacgatgtgaccatgatccccatgtcattgcagccgtggctaaacttttctgg
catgataggaagtttgataaagctaggagttggttgaacagagctgttactcttgctcca
gacattggagatttttgggccttgtactacaaattcgaactacaacatggaaacgctgat
acacataaggatgttgtacaacgatgtgttgcatcagaaccaaagcatggagagagatgg
caagcaatagcgaaggctgttgagaactcacacctgtcgattgaggcccttctgaagaaa
gctgtggtggctcttggccaggatgaaaatccaaatgctgtagatccctag

DBGET integrated database retrieval system