KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349044
Entry
4349044           CDS       T01015                                 
Name
(RefSeq) glutamyl-tRNA reductase, chloroplastic
  KO
K02492  glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4349044
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.70  glutamyl-tRNA reductase
     4349044
SSDB
Motif
Pfam: Shikimate_DH GlutR_N GlutR_dimer F420_oxidored NAD_binding_2 NAD_binding_10 OCD_Mu_crystall UDPG_MGDP_dh_N TrkA_N Sacchrp_dh_NADP 2-Hacid_dh_C ApbA KR NAD_binding_7 ThiF Glu_dehyd_C DapB_N Gp_dh_N FANCI_S1-cap DUF6200
Other DBs
NCBI-GeneID: 4349044
NCBI-ProteinID: XP_015614701
UniProt: P0C587
LinkDB
Position
10:complement(19159169..19162499)
AA seq 537 aa
MMASTTSATAAGGAFAAAKTRAGSSAAGGGACARVAAGGRRRSGVVVRCDAGVEAQAQAQ
AVAKAASVAALEQFKISADRYMKERSSIAVIGLSVHTAPVEMREKLAVAEELWPRAISEL
TSLNHIEEAAVLSTCNRMEIYVVALSWNRGIREVVDWMSKKSGIPASELREHLFMLRDSD
ATRHLFEVSAGLDSLVLGEGQILAQVKQVVRSGQNSGGLGKNIDRMFKDAITAGKRVRCE
TNISSGAVSVSSAAVELALMKLPKSECLSARMLLIGAGKMGKLVVKHLIAKGCKKVVVVN
RSVERVDAIREEMKDIEIVYRPLTEMYEAAAEADVVFTSTASETPLFTKEHAEALPAISD
AMGGVRLFVDISVPRNVSACVSEVGHARVYNVDDLKEVVEANKEDRLRKAMEAQTIITQE
LKRFEAWRDSLETVPTIKKLRSYADRIRASELEKCLQKIGEDALTKKMRRSIEELSTGIV
NKLLHGPLQHLRCDGSDSRTLDETLENMHALNRMFSLDTEKAIIEQKIKAKVEKSQN
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgatggcgagcacgacgtcagcgacggccgccgggggcgcgttcgccgccgcgaagacg
cgggcggggtcgtcggcggcgggcggcggcgcgtgcgcgagggtcgccgccggcgggcgg
aggcggtccggcgtggtggtgcggtgcgacgccggcgtggaggcgcaggcccaggcgcag
gcggtggccaaggccgccagcgtcgccgcgctcgagcagttcaagatctccgccgaccgg
tacatgaaggaaagaagtagcatagcggtaataggcctcagtgtacacactgcaccagtg
gagatgcgtgagaaacttgctgttgcagaggaactatggccccgtgctatctcagaactc
accagtctgaatcatattgaagaggctgctgttcttagtacctgcaatagaatggaaatc
tatgtggtagctttatcgtggaaccgtgggattagagaagtggtagactggatgtcaaag
aaaagtggaatccctgcttctgagctcagggagcatctattcatgttgcgtgacagtgat
gccacacgccatctgtttgaggtatctgctgggcttgactctttggttcttggagaaggg
caaatccttgctcaagttaaacaagttgtcagaagtgggcaaaacagtggaggcttggga
aagaacatcgataggatgttcaaggatgcaatcactgctggaaagcgtgtccgctgcgag
actaacatatcatcaggtgctgtctctgtcagttcagctgcagttgaattggccttgatg
aagcttccaaagtcggaatgcctatctgctaggatgctgttgattggtgctggcaagatg
ggaaagttggtggttaaacatttgattgccaagggatgcaagaaagttgttgtggtgaac
cgttcagtggaaagggtggatgccatccgcgaagagatgaaagacattgagattgtgtac
aggcctcttacagagatgtatgaagccgctgccgaagctgatgtcgtgttcacaagcacg
gcatccgaaaccccattgttcacaaaggagcacgcagaggcgcttcccgctatttctgat
gctatgggtggtgttcgactctttgtcgacatatccgtccccagaaatgtcagcgcctgt
gtgtctgaagttggccatgcgcgagtatacaacgtcgatgacttgaaagaggttgtggaa
gccaacaaggaggaccggcttaggaaagcaatggaggcccaaacaatcatcacccaagaa
ttgaaacggttcgaggcatggagggactcgctggagactgttccgactatcaagaagctg
aggtcctacgccgacaggatcagggcttcggagcttgagaagtgcctccagaagatcggc
gaagacgccctcaccaagaagatgagaagatccatcgaggagctcagcaccggcatcgtg
aacaagcttctccacggcccattgcagcacctgagatgtgacggcagcgacagccgcacc
ctcgatgagacgctggagaacatgcacgccctcaacaggatgttcagcctcgacaccgag
aaggcgatcattgagcagaagatcaaggcgaaggtggagaagtcccagaactga

DBGET integrated database retrieval system