KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349097
Entry
4349097           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 84A1
  KO
K09755  ferulate-5-hydroxylase [EC:1.14.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4349097
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4349097
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     4349097
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP84 family
   4349097
SSDB
Motif
Pfam: p450 DUF3292
Other DBs
NCBI-GeneID: 4349097
NCBI-ProteinID: XP_015614553
UniProt: Q109F2 Q0IWF8
LinkDB
Position
10:complement(19728279..19735036)
AA seq 530 aa
MADMVKFTMEWLQDPLSLAIVVTVAVLIMRMQRRRAAPFPPGPKPLPIVGNMAMMDQLTH
RGLAALAKEYGGLMHLRLGRLHAFAVSTPEYAREVLQAQDGAFSNRPATTAIAYLTYDRA
DMAFAHYGPFWRQMRKLCVVKLFSRRRAETWLAVRDESAALVRAVAASRGEAAVNLGELI
FNLTKNVIFRAAFGTRDGEGHDEFIAILQEFSKLFGAFNIGDFIPWLSWADTNGINARLV
AARTALDRFIDKIIDEHMERGKNPDDADADMVDDMLAFLAEAKPHAGKAAAAAAGAGDGA
DDLQNTLRLTRDNIKAIIMDVMFGGTETVASAIEWAMAEMMHSPDDLRRVQEELAAVVGL
GRDVAESDLDKLPFLRCVIKETLRLHPPIPILLHETAADCLVAGYSVPRGSRVMVNVWAI
ARDRAAWGPDADAFRPSRFAAGAAAEGLDFRGGCFEFLPFGSGRRSCPGMALGLYALELA
VARLAHGFNWSLPDGMKPSELDMSDIFGLTAPRATRLSAVATPRLTCPLY
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggcggacatggtgaagttcaccatggagtggcttcaggatcctctgagcctggcgatc
gtcgtcacggtggccgtcctaatcatgcggatgcagcggcggcgcgcggcgccgttcccg
ccggggccgaagccgctgccgatcgtcggcaacatggcgatgatggaccagctgacgcac
cgcggcctggcagcgctggcgaaggagtacggcggcctgatgcacctccggctcggccgg
ctccacgcgttcgccgtgtcgacgccggagtacgcgcgcgaggtgctccaggcgcaggac
ggcgcgttctcgaacaggccggcgaccacggcgatcgcctacctcacctacgaccgcgcg
gacatggcgttcgcgcactacgggcccttctggcgccagatgaggaagctgtgcgtggtg
aagctcttcagccggcgccgcgccgagacgtggctcgccgtgcgcgacgagtccgcggcg
ctcgtgcgcgccgtggcggcgtcgcgcggcgaggccgccgtcaacctcggcgagctcatc
ttcaacctcaccaagaacgtcatcttccgcgccgcgttcggcacgcgcgacggcgagggg
cacgacgagttcatcgccatcctccaggagttctccaagctgttcggcgcgttcaacatc
ggcgacttcatcccctggctcagctgggcggacaccaacggcatcaacgcccgcctcgtc
gcggcgcgcaccgcgctcgacaggttcatcgacaagatcatcgacgagcacatggagcgc
ggcaagaaccccgacgacgccgacgccgacatggtcgacgacatgctcgcgttcctcgcc
gaggccaagccgcacgccggcaaggccgccgccgccgccgccggcgccggcgacggggcc
gacgacctgcagaacacgctccgcctcacccgcgacaacatcaaggccatcatcatggac
gtgatgttcggggggacggagacggtggcgtcggcgatcgagtgggcgatggcggagatg
atgcacagccccgacgacctccgccgcgtgcaggaggagctcgccgccgtggtgggcctc
ggccgggacgtcgccgagtccgacctcgacaagctccccttcctccgctgcgtcatcaag
gagacgctccgcctccacccgcccatccccatcctcctccacgagaccgccgccgactgc
ctcgtcgccggctactccgtccccaggggctcccgcgtcatggtcaacgtgtgggccatc
gcccgcgaccgcgccgcctggggccccgacgccgacgcgttccgcccctcgcggttcgcc
gccggcgccgccgccgaggggctcgacttcaggggcggctgcttcgagttcctccccttc
ggctccggccgccgctcgtgcccgggcatggcgctggggctctacgcgctcgagctcgcc
gtcgcgcggctcgcccacggcttcaactggtcgctccccgacgggatgaagccgtccgag
ctcgacatgtccgacatcttcggcctcaccgcgccgcgcgccacccgcctctccgccgtc
gccacgccccggctcacctgccccttgtactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270922
Entry
9270922           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 84A1
  KO
K09755  ferulate-5-hydroxylase [EC:1.14.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    9270922
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    9270922
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     9270922
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP84 family
   9270922
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 9270922
NCBI-ProteinID: XP_015630502
UniProt: Q0DVU2 Q8GZY1
LinkDB
Position
3:complement(726213..729857)
AA seq 519 aa
MANGVAEYLLMDPWLVLWLVLASMAFALLHLRRRARRGAPPLPPGPRPLPIIGNMLMMDQ
LTHRGLAAMAARYGGLLHLRLGRVHMVVVSSPEHAREVLQVQDGDFSNRPASIAIAYLTY
GRADMAFSHYGHFWRQVRKLSAVRLFSRRRAQSWRAVRDESAKLVGAIARRAGEAVDLGE
LIFGLTKDVIFRAAFGTRDGGGHGELEVLLQEFSKLFGAFNVGDFIPWLAWLDPHGINRR
LRAARAALDSVIDRIIDEHVSNPAGDEDADMVDDMLAFLDEAGRDQTGGGGELQGTLRLT
RDNIKAIIMDFVFGGTETVASAIEWAMAELLHSPGDLRRLQAELADVVGLGRGVEEGDLE
KLPFLRCVAMETLRLHPPIPLLLHEAAADCVVGGYSVPRGARVVVNVWSVGRDAGAWKGD
AGAFRPARFMAGGEAAGMDLRGGCFELLPFGSGRRACPAIVLGMYELELVVARLVHAFGW
APPGGVAPEELDMADGFGLTAPRAARLRAVPTPRLTCPM
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggcgaacggcgtggcagagtacttgctgatggacccgtggcttgttctatggctcgtc
ctggcctccatggcgttcgcattgctgcacctgcggcggcgcgcacgccgtggggcgccg
ccgctgccgccgggtccgcggccgctgccgatcatcggaaacatgctcatgatggaccag
ctgacgcaccgcgggctggcggccatggcggccaggtacggcgggttgctgcacctccgc
ctcggccgcgtccacatggtggtggtgtcgagcccggagcacgcgcgcgaggtgctccag
gtccaggacggcgacttctccaaccggccggcgagcatcgccatcgcctacctcacctac
ggccgcgccgacatggccttctcccactacggccacttctggcgacaggtgcgcaagctc
agcgccgtgcggctcttcagccggcggcgcgcccagtcgtggcgcgccgtccgcgacgag
tcggccaagctggtcggcgccattgccaggagagccggcgaggccgtcgacctcggtgag
ctcatcttcgggctcaccaaggacgtcatctttcgcgccgccttcggcacgcgcgacggc
ggcggccacggcgagctggaggttctcctgcaggagttctccaagctgttcggcgcgttc
aacgtcggggacttcatcccctggctcgcgtggctcgacccgcacggcatcaaccgacgg
ctccgcgcggcgcgcgccgccctcgacagcgtcatcgacaggatcatcgacgagcacgtc
agcaaccccgccggcgacgaggacgccgacatggtggacgacatgctcgcgttcctcgac
gaggccggacgagaccaaaccggcggcggcggcgagctgcagggcacgctccggctgacg
cgcgacaacatcaaggccatcataatggacttcgtcttcggcgggacggagacggtggcg
tcggcgatcgagtgggcgatggcggagttgctgcacagccccggcgatctccggcggctg
caggcggagctcgccgacgtggtggggctcgggcgcggcgtggaggagggcgacctggag
aagctccccttcctcaggtgcgtcgccatggagacgctgcgtctccacccgccgatcccg
ctgctcctccacgaggcggcggcggactgcgtcgtcggcgggtactccgtgccgaggggc
gcccgcgtggtggtcaacgtgtggagcgtcggccgcgacgccggcgcgtggaagggcgac
gccggcgcgttccggccggcgaggttcatggcgggcggcgaggcggcggggatggacctc
aggggcggatgcttcgagctcctgccgttcgggtcggggcggagggcgtgccccgccatc
gtgctcgggatgtacgagctggagctcgtcgtcgcgcgcctcgtccacgcgttcgggtgg
gcgccgccgggcggcgtggcgccggaggagctcgacatggcggacggcttcggcctcacc
gcgccgcgcgccgcgaggctccgcgccgtgccgacgccccggctcacctgcccgatgtga

DBGET integrated database retrieval system