KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349430
Entry
4349430           CDS       T01015                                 
Name
(RefSeq) chlorophyllide a oxygenase, chloroplastic-like
  KO
K13600  chlorophyllide a oxygenase [EC:1.14.13.122]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4349430
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.122  chlorophyllide-a oxygenase
     4349430
SSDB
Motif
Pfam: Rieske PaO VanA_C Crescentin KshA_C YscO Vps5
Other DBs
NCBI-GeneID: 4349430
NCBI-ProteinID: XP_015614091
UniProt: Q336R0 A0A8J8Y7F8
LinkDB
Position
10:complement(22473500..22478044)
AA seq 542 aa
METTVSLLPHLLVKPSSSFSCCFTMGIGRRYGRIKVYAVLGDDEAQHAKNNMRGALFHVD
NPGPMAPIAKGNFLDVNQALEVVRFGIQYCDWRARQDLLTIMVLHNKVVEVLKSLAIEFK
SNGTLRKELAELQEELAKAHNQVHLSETRASSALDKLAQADNLVNDRLLQDGGSSASIDN
YVSLASRTSSASRFVNKKTLRPSLDVSGPVQPYNPNLKNFWYPVVFSGDLKDDTMVPIDC
FEEQWVIFRGKDGRPGCVQNTCAHRACPLHLGSVSEGRIQCPFHGWEYSTDGKCEKMPAT
KLLNVRIRSLPCFEQEGMVWIWPGDGTPESTIPSLQPPSGFTIHAEMVMELPVEHGLLLD
NLLDIAHAPFAHTSTFAKGWSVPSLVKFLTPASGLQGYWDPYPIDMEFRPPCMVLSTTGI
SKPGKLEGKSIKQCSTHLHQLHICLPSSRNKTRMLYQMSLNFAPWLKHIPFMHILWSHFG
EKVLNEDLRLVLGQQERMINGANVWNWPVSYDKLGIRYRLWRDAIERGANRLPFNNQSES
GS
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggaaaccactgtgtctttgctgccgcacctgctcgtcaagccttcctcctccttcagc
tgttgcttcacaatgggcattggtcgtcgatatggaagaatcaaggtgtatgcagtgctc
ggtgatgatgaagctcaacatgccaagaacaacatgaggggggccttgttccatgtcgat
aaccccgggccaatggctcccattgcaaaaggcaacttcttggatgttaaccaggccctt
gaggtggtccgattcggcatccagtactgcgattggagggcgcggcaggacctcctcacc
atcatggttctgcacaacaaggtggtagaggttctcaaatctttagcaatagagttcaag
tcaaatggaaccttgaggaaagagcttgcagagttgcaggaagaattggccaaagctcac
aatcaggttcatttatcagaaactagagcatcatctgcacttgataagttagcacaagcg
gataacctggtgaatgacagactgttgcaagacggaggctctagtgcatctatagacaac
tatgtttctcttgcttcaagaacgtcatcagcgtcccgttttgtgaacaagaaaactctg
cgtccgagtctggacgtgtctggtccagtgcagccatacaatcccaatctgaaaaacttc
tggtacccagttgtcttctccggtgacctgaaagatgatacaatggtaccaatagattgt
tttgaggagcagtgggtaattttccgaggaaaggatgggagacctggatgtgttcagaac
acatgtgctcacagagcctgccctcttcatcttggctcagttagtgagggtagaatccaa
tgccctttccatgggtgggagtattcaactgatggaaaatgtgagaaaatgccagccacg
aagttgctcaatgtgcgcatccggtcattgccatgctttgagcaagaaggcatggtttgg
atctggcctggtgatggcacaccggagtcgactatcccttctctgcagcccccttcagga
tttacaattcatgcagagatggtgatggagctaccggtggagcatggacttctgctggac
aatctattagatattgctcatgctccttttgctcatacgtccacctttgccaagggttgg
agtgttccaagcttggtgaagttcttgacacctgcatctgggctccaagggtactgggat
ccttaccccatcgacatggagtttcgaccgccatgcatggtcttgtcaaccactggcatc
tcaaagcctggaaaactagagggaaagagcatcaagcaatgttccacacatctccaccaa
ctccatatctgcttgccctcctccaggaataaaaccaggatgctgtaccagatgtccctc
aactttgctccctggctcaagcacatccctttcatgcacatactatggtcacattttggt
gagaaggtcttgaatgaggacctacggcttgtgcttgggcagcaagagcggatgataaat
ggcgcgaacgtatggaactggccagtgtcatatgacaagcttggtatccggtatcggtta
tggagagacgccattgagaggggagcaaacaggttgccattcaataaccaaagtgagagt
ggatcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349433
Entry
4349433           CDS       T01015                                 
Name
(RefSeq) chlorophyllide a oxygenase, chloroplastic
  KO
K13600  chlorophyllide a oxygenase [EC:1.14.13.122]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4349433
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.122  chlorophyllide-a oxygenase
     4349433
SSDB
Motif
Pfam: Rieske VanA_C PaO YscO HrpB7 Rab_eff_C IpaC_SipC FliJ Vps5
Other DBs
NCBI-GeneID: 4349433
NCBI-ProteinID: XP_015614086
UniProt: Q8S7E1
LinkDB
Position
10:complement(22482881..22486532)
AA seq 541 aa
MTTVASLSLLPHLLIKPSFRCCSRKGVGRYGGIKVYAVLGDDGADYAKNNAWEALFHVDD
PGPRVPIAKGKFLDVNQALEVVRFDIQYCDWRARQDLLTIMVLHNKVVEVLNPLAREFKS
IGTLRKELAELQEELAKAHNQVHLSETRVSSALDKLAQMETLVNDRLLQDGGSSASTAEC
TSLAPSTSSASRVVNKKPPRRSLNVSGPVQPYNPSLKNFWYPVAFSSDLKDDTMVPIDCF
EEQWVIFRGKDGRPGCVMNTCAHRACPLHLGSVNEGRIQCPYHGWEYSTDGKCEKMPSTK
MLNVRIRSLPCFEQEGMVWIWPGNDPPKSTIPSLLPPSGFTIHAEIVMELPVEHGLLLDN
LLDLAHAPFTHTSTFAKGWSVPSLVKFLTPSSGLQGYWDPYPIDMEFRPPCMVLSTIGIS
KPGKLEGKSTKQCSTHLHQLHICLPSSRNKTRLLYRMSLDFAPWIKHVPFMHILWSHFAE
KVLNEDLRLVLGQQERMINGANVWNWPVSYDKLGIRYRLWRDAIERGVDRLPFSNQSESG
S
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgaccactgtggcatcgctgtctttgctgccgcacttgctcatcaagccttccttcagg
tgttgctccagaaagggtgttggtagatatggaggaatcaaggtgtatgcggtgctcggt
gatgatggagctgactatgcaaagaacaacgcatgggaggccttgttccatgtcgatgac
ccggggccaagggttccaattgcaaaaggcaagttcttggatgtcaaccaagctcttgag
gtggtccggttcgatatccagtattgcgattggagggcgcggcaggacctcctcaccatc
atggttcttcacaacaaggtggtagaggttcttaatcctttagcaagggagttcaagtca
attggaaccttgaggaaagagcttgcagaattacaggaagaattggcaaaagctcacaat
caggttcatctgtcggaaactagagtatcatctgcccttgataagttggcacaaatggag
acccttgtcaacgacagactgttgcaagatggaggctctagcgcatctacagccgagtgc
acttcccttgctccaagcacgtcatcagcgtcccgtgttgtaaacaagaaacctcctcgc
cggagtctgaacgtgtctggtccagtgcagccatacaatcccagtctgaagaacttctgg
tacccagttgctttctccagtgacctaaaagacgatacaatggtgccaatagattgtttt
gaggagcagtgggtaattttccgaggaaaggatgggagacctggatgtgttatgaacaca
tgtgctcacagagcttgccctcttcatcttggctcagttaatgagggcagaatccaatgc
ccttaccatggttgggagtattcaactgatggaaaatgtgagaaaatgccatccacaaag
atgctcaacgtgcgcatccggtcattaccatgctttgagcaagaaggaatggtttggata
tggcctggcaatgacccaccgaagtcgactatcccttctctgctgcctccttcaggattt
acaattcacgcagagatagtgatggagctaccagtggagcatggacttcttctggacaat
ctattagatcttgctcatgctccttttactcatacatccacctttgccaagggttggagt
gttccaagcttggtgaagttcttgacaccttcatctgggcttcaaggatactgggatcca
tacccgatcgacatggaatttcgaccaccatgcatggtgttgtcaaccattggcatctca
aagcctggaaaactagaggggaagagcaccaagcaatgttcgacgcatctccaccagctc
catatctgtttgccctcctctaggaataaaaccaggctgctctaccggatgtctctcgac
ttcgctccatggatcaagcatgtccctttcatgcatatactatggtcacattttgctgag
aaggtcttgaatgaggatcttcgactcgtgctcgggcagcaagaacggatgatcaatggc
gcaaatgtctggaactggccagtatcatatgacaagcttggtatccggtatcggttgtgg
agagacgccattgagaggggagtagacaggttgccattcagtaaccaaagtgagagtgga
tcatag

DBGET integrated database retrieval system