KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349546
Entry
4349546           CDS       T01015                                 
Name
(RefSeq) clathrin heavy chain 1
  KO
K04646  clathrin heavy chain
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4349546
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4349546
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4349546
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    4349546
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4349546
SSDB
Motif
Pfam: Clathrin Clathrin_propel Clathrin_H_link Clathrin-link
Other DBs
NCBI-GeneID: 4349546
NCBI-ProteinID: XP_015616901
UniProt: Q2RBN7
LinkDB
Position
11:234133..244448
AA seq 1708 aa
MAAANAPIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIVDMAMPAQ
PLRRPITADSALMNPNTRILALKAQIPGTTQDHLQIFNIEAKTKIKSHQMPEQVVFWKWI
TPKLLGLVTQTSVYHWSIEGDSEPAKMFDRTANLANNQIINYRCDPSEKWLVLIGIAPGA
PERPQLVKGNMQLFSVDQQRSQALEAHAASFASFKVVGNENPSTLICFASKTTNAGQITS
KLHVIELGAQPGKPGFSKKQADLFFPPDFQDDFPVAMQISQKYGLIYVITKLGLLFVYDL
ETAAAVYRNRISPDPIFLTAESSASGGFYAINRRGQVLHATVNDATIVPFVSSQLNNLEL
AVNLAKRANLPGAENLVVQRFQELFAQTKYKEAAELAAESPQGLLRTPETVAKFQSVPVQ
AGQTPPLLQYFGTLLTRGKLNAYESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KTVDNDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYLFLLQTILRTDPQ
GAVNFALMMSQMEGGCPVDYNTITDLFLQRNMIREATAFLLDVLKPNLPEHAFLQTKVLE
INLVTYPNVADAILANGMFSHYDRPRVAQLCEKAGLYLRALQHYTELPDIKRVMVNTHAI
EPQALVEFFGTLSREWALECMKDLLLVNLRGNLQIVVQAAKEYSEQLGVDACIKLFEQFK
SYEGLYFFLGAYLSSSEDPDIHFKYIEAAARTGQIKEVERVTRESNFYDAEKTKNFLMEA
KLPDARPLINVCDRFGFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE
DFIKGLILSVRSLLPVEPLVDECEKRNRLRLLTQFLEHLVSEGSQDVHVHNALGKIIIDS
NNNPEHFLTTNPFYDSRVVGKYCEKRDPTLAVVAYRRGQCDDELINVTNKNSLFKLQARY
VVERMDGDLWDKVLQPENEYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIE
LLEKIVLQNSAFSGNFNLQNLLILTAIKADPSRVMDYVNRLDNFDGPAVGEVAVEAQLFE
EAFAIFKKFNLNVQAVNVLLDNIRSIERAEEFAFRVEEDAVWSQVAKAQLREGLVSEAIE
SFIRADDATHFLDVIRAAEEANVYDDLVKYLLMVRQKAREPKVDGELIFAYAKIDRLSDI
EEFILMPNVANLQNVGDRLYDEELYEAAKIIYAFISNWAKLAVTLVKLKQFQGAVDAARK
ANSAKTWKEVCFACVDAEEFRLAQICGLNIIVQVDDLEEVSEYYQNRGCFNELISLMESG
LGLERAHMGIFTELGVLYARYRPEKLMEHIKLFSTRLNIPKLIRACDEQQHWKELTYLYI
QYDEFDNAATTIMNHSPDAWDHMQFKDVAVKVANVELYYKAVHFYLQEHPDLINDLLNVL
ALRLDHTRVVDIMRKAGQLHLVKPYMVAVQSNNVSAVNEALNELYVEEEDYERLRESVDM
HDNFDQIGLAQKLEKHELLEMRRIAAYIYKKAGRWKQSIALSKKDNMYKDCMETCSQSGD
RELSEDLLVYFIEQGKKECFASCLFICYDLIRADVALELAWMNNMVDFAFPYLLQFIREY
TSKVDELVKDRIESQNEVRAKEKEEKDLVAQQNMYAQLLPLALPAPPGMGGPPPPMGMPG
MPPMGGMGMPPMGPGPMPAYGMPPMGSY
NT seq 5127 nt   +upstreamnt  +downstreamnt
atggcggcggccaacgcccccatcgccatgcgcgaggccctcacgctcaccagcctgggg
atcgcgccccagttcgtcaccttcacccacgtcaccatggagtcggagaaatacatctgc
gtccgcgagacctccccgcagaacagcgtcgtcatcgtcgacatggccatgcccgcgcag
cccctccgcaggcccatcaccgccgactccgccctcatgaaccccaacacccgcatcctc
gccctcaaagctcaaatacctgggacaacacaggatcacctgcaaatcttcaacattgag
gctaaaacaaaaattaagtcccaccagatgcctgagcaggttgtgttttggaaatggatc
accccaaagttgttgggtttggtaacacaaacatcagtttatcactggtcaattgaggga
gattctgaaccggccaagatgttcgataggacggctaatttggccaacaatcaaattatc
aactatcgatgtgatccatctgagaagtggcttgtgcttattggaattgcacctggtgct
ccagagaggccacaactggtgaagggaaatatgcaacttttttctgtggatcagcaacgt
agtcaggcacttgaagcccatgcagcatcctttgcatcatttaaggtcgtgggcaacgag
aacccttcaactctcatctgctttgcctcaaagacaactaatgctgggcagatcacttct
aagttgcatgttattgaattgggtgcccagccagggaaaccagggttttccaagaagcaa
gctgatcttttcttccccccagattttcaggatgattttcctgtggccatgcagatctct
cagaagtatggccttatctatgtaattacgaagcttggccttttatttgtatatgacttg
gaaacagctgcagcggtctatagaaatagaattagtccagatcctatattcttgacagca
gagtcttctgcaagtggtggtttttatgccatcaataggagaggacaggttttacatgcc
acagttaatgatgcaaccattgtgccttttgtcagcagtcaattaaataaccttgaacta
gctgtaaatcttgccaaaagagctaatcttcctggggcagagaacttagttgtgcaaagg
tttcaagaattgtttgcacaaacaaaatacaaggaagcagctgagttggctgcagaatct
cctcaaggtcttctccgaactcctgagactgttgcaaaatttcagagtgttcctgttcaa
gctgggcaaacgcctccactcttgcagtactttggcacattgctaactcgggggaagctc
aatgcttacgagtctcttgagctatctcgacttgttgtcaatcagaacaaaaagaacctt
ttggaaaactggttggctgaagacaaattggagtgcagtgaagaacttggagatcttgtc
aagactgtggacaatgatcttgctctgaaaatatacataaaggctagggcaacccctaaa
gttgttgccgcttttgctgaaagaagggaatttgacaagatccttatatattcaaagcag
gttggatacacccctgactacctcttcctcctccagaccattttacgtacggatccacag
ggagctgtcaactttgcgctcatgatgtcacaaatggaggggggctgtccagttgattac
aatactataactgatctcttccttcagagaaacatgatacgtgaggcaacagctttcctg
ctggatgttttaaagccaaacttgccggagcatgcttttcttcaaaccaaggttttggag
atcaacttggtcacttacccaaatgttgctgatgccatccttgctaatggtatgttcagt
cattatgatcgccctcgtgttgctcagctttgtgaaaaggctggcttgtacttgcgagct
ctccagcattacacagaattaccagatatcaagcgtgtcatggtgaatacccatgccatt
gagccacaggcacttgttgagttctttggcactctttcaagagagtgggctttggagtgc
atgaaggaccttctgctggtcaatctaagagggaatcttcaaattgttgtacaggctgcc
aaagaatactctgagcagctaggggttgatgcttgcataaaactgtttgagcaattcaaa
tcttacgagggcctttactttttcttgggagcttatttgagttccagtgaggatccagat
attcatttcaaatacatagaagcagctgctaggactggacagatcaaagaagttgaacgt
gtaaccagggaatccaacttttatgatgcggagaagacaaagaactttttaatggaagcg
aaactgcctgatgcccgtccgctgattaatgtctgcgaccgctttggatttgttccagat
ttgacccactatctgtatacaaataatatgcttcggtatattgaaggctatgtacagaaa
gtgaaccctggaaatgctccattagttgttggacagctacttgatgatgagtgccctgaa
gatttcattaagggtttgattctgtctgtccgttctctccttcctgttgagccactagtt
gatgaatgcgagaagaggaaccgcctacggctgctgacacaatttttggagcacttagtg
agcgagggtagccaagatgtccatgtgcacaatgctcttggaaaaatcatcattgacagc
aacaataatcctgagcacttccttaccaccaatccattttatgactctcgcgtggtcggt
aaatactgtgaaaagcgggatcctacccttgctgttgttgcttacagacgtggacagtgt
gatgatgaacttattaatgtcaccaataaaaactcactgttcaagctgcaagctaggtat
gtggttgaaagaatggatggtgatctgtgggataaagttctacagcctgaaaatgaatat
agaaggcaactcattgaccaagtggtttctacggctttgcctgaaagcaagagccccgag
caagtgtctgctgctgttaaggctttcatgacagctgatcttccccatgaactgattgaa
cttcttgaaaagatcgtccttcagaattctgctttcagtggaaacttcaatctgcagaac
cttctcatcttgacagccatcaaggctgacccatccagggtcatggactatgtcaacagg
ctggacaactttgatgggcctgctgttggagaagtagcagttgaagcacagctgtttgag
gaggctttcgctatcttcaagaagttcaacttaaatgtgcaggctgtcaatgttctattg
gacaacatccgaagcatagaaagagctgaagagtttgcattccgtgttgaagaagatgct
gtttggagccaggttgccaaggcccagttgcgtgaaggtttggttagtgaagcaattgag
tccttcattcgtgcagatgatgcaacacatttcctcgacgtcatccgtgctgctgaggaa
gctaatgtatacgatgatctagttaagtacttgcttatggtaaggcagaaggcaagggaa
cccaaagttgatggagaactcatctttgcgtatgctaagattgatagactcagtgatatt
gaagagttcattctcatgccaaatgttgccaatcttcaaaatgttggtgatcgtctgtat
gatgaagaactttatgaagcagcaaagatcatctatgccttcatctcaaactgggctaag
ctggctgttacccttgttaagctgaagcagttccaaggtgctgtggatgctgctcgcaag
gctaacagtgctaaaacatggaaggaagtctgctttgcttgtgttgatgccgaggagttc
cggctagcacaaatatgtggtctcaatattattgtccaggttgatgatttggaggaagta
agtgaatactaccagaacagaggatgtttcaatgaacttatttccctcatggaaagtggt
ctaggactggagcgtgctcacatgggcatcttcacagaattaggagtcctctatgctaga
tatcgccctgagaagctcatggaacacatcaaacttttctccacacgtctcaacattcct
aagcttatccgtgcttgtgatgaacagcagcactggaaagagcttacttacctatacatc
cagtatgatgaatttgacaatgctgccaccactattatgaaccattctccggatgcatgg
gatcatatgcaatttaaggatgttgctgttaaagttgcaaatgttgagctatactacaag
gcagtgcacttctatctgcaagagcatcctgatctcatcaatgaccttctcaatgtactt
gcgcttcgtttggatcatacaagagtcgtggacataatgcgcaaggctggtcagttgcat
cttgtgaaaccatacatggttgcagttcagagcaacaatgtctctgctgtgaatgaagct
ttgaatgagctttatgttgaagaggaggactatgagagactccgtgaatcggttgatatg
catgacaactttgatcagataggtcttgcccaaaagcttgagaagcatgaattgcttgag
atgaggaggatcgctgcctacatttacaagaaggctggcagatggaagcaatctattgcc
ctgtcgaagaaagacaacatgtacaaggattgcatggagacatgctcacagtctggtgac
cgcgagctgtcagaagatttgcttgtctatttcattgaacagggaaagaaagaatgcttt
gcttcttgtctctttatttgttatgacttgatccgtgcggatgttgctcttgagcttgca
tggatgaacaacatggtggactttgcattcccctatctgttacagttcattcgggagtac
acaagcaaggttgatgagctagtgaaggacaggattgaatcacagaatgaagtaagggct
aaagagaaggaagaaaaagatcttgttgctcagcagaacatgtatgcccaattgcttcct
ctcgccttgcctgctccacctggtatgggcggtcctccaccgccaatggggatgccgggc
atgcctccgatgggcggaatggggatgcctccgatgggtcccggacctatgccagcatat
gggatgcctccaatgggaagctactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351255
Entry
4351255           CDS       T01015                                 
Name
(RefSeq) clathrin heavy chain 2
  KO
K04646  clathrin heavy chain
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4351255
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4351255
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4351255
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    4351255
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4351255
SSDB
Motif
Pfam: Clathrin Clathrin_propel Clathrin_H_link Clathrin-link
Other DBs
NCBI-GeneID: 4351255
NCBI-ProteinID: XP_015619821
UniProt: Q2QYW2
LinkDB
Position
12:249587..259739
AA seq 1708 aa
MAAANAPIAMREALTLTSLGIAPQFVTFTHVTMESEKYICVRETSPQNSVVIVDMAMPAQ
PLRRPITADSALMNPNTRILALKAQIPGTTQDHLQIFNIEAKTKIKSHQMPEQVVFWKWI
TPKLLGLVTQTSVYHWSIEGDSEPAKMFDRTANLANNQIINYRCDPSEKWLVLIGIAPGA
PERPQLVKGNMQLFSVDQQRSQALEAHAASFASFKVVGNENPSTLICFASKTTNAGQITS
KLHVIELGAQPGKPGFSKKQADLFFPPDFQDDFPVAMQISQKYGLIYVITKLGLLFVYDL
ETAAAVYRNRISPDPIFLTAESSASGGFYAINRRGQVLHATVNDATIVPFVSSQLNNLEL
AVNLAKRANLPGAENLVVQRFQELFAQTKYKEAAELAAESPQGLLRTPDTVAKFQSVPVQ
AGQTPPLLQYFGTLLTRGKLNAYESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KTVDNDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYLFLLQTILRTDPQ
GAVNFALMMSQMEGGCPVDYNTITDLFLQRNMIREATAFLLDVLKPNLPEHAFLQTKVLE
INLVTYPNVADAILANGMFSHYDRPRVAQLCEKAGLYLRALQHYTELPDIKRVMVNTHAI
EPQALVEFFGTLSREWALECMKDLLLVNLRGNLQIVVQAAKEYSEQLGVDACIKLFEQFK
SYEGLYFFLGAYLSSSEDPDIHFKYIEAAARTGQIKEVERVTRESNFYDAEKTKNFLMEA
KLPDARPLINVCDRFGFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE
DFIKGLILSVRSLLPVEPLVDECEKRNRLRLLTQFLEHLVSEGSQDVHVHNALGKIIIDS
NNNPEHFLTTNPFYDSRVVGKYCEKRDPTLAVVAYRRGQCDDELINVTNKNSLFKLQARY
VVERMDGDLWDKVLQPENEYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIE
LLEKIVLQNSAFSGNFNLQNLLILTAIKADPSRVMDYVNRLDNFDGPAVGEVAVEAQLFE
EAFAIFKKFNLNVQAVNVLLDNIRSIERAEEFAFRVEEDAVWSQVAKAQLREGLVSEAIE
SFIRADDATHFLDVIRAAEEANVYDDLVKYLLMVRQKAREPKVDGELIFAYAKIDRLSDI
EEFILMPNVANLQNVGDRLYDEELYEAAKIIYAFISNWAKLAVTLVKLKQFQGAVDAARK
ANSAKTWKEVCFACVDAEEFRLAQICGLNIIVQVDDLEEVSEYYQNRGCFNELISLMESG
LGLERAHMGIFTELGVLYARYRPEKLMEHIKLFSTRLNIPKLIRACDEQQHWKELTYLYI
QYDEFDNAATTIMNHSPDAWDHMQFKDVAVKVANVELYYKAVHFYLQEHPDLINDLLNVL
ALRLDHTRVVDIMRKAGQLHLVKPYMVAVQSNNVSAVNESLNELYVEEEDYERLRESVDM
HDNFDQIGLAQKLEKHELLEMRRIAAYIYKKAGRWKQSIALSKKDNMYKDCMETCSQSGD
RELSEDLLVYFIEQGKKECFASCLFICYDLIRADVALELAWMNNMVDFAFPYLLQFIREY
TSKVDELVKDRIESQNEVRAKEKEEKDLVAQQNMYAQLLPLALPAPPGMGGPPPPMGMPG
MPPMGGMGMPPMGPGPMPAYGMPPMGSY
NT seq 5127 nt   +upstreamnt  +downstreamnt
atggcggcggccaacgcccccatcgccatgcgcgaggcgctcacgctcaccagcctgggg
atcgcgccccagttcgtcaccttcacccacgtcaccatggagtcggagaaatacatctgc
gtccgcgagacctccccgcagaacagcgtcgtcatcgtcgacatggccatgcccgcgcag
cccctccgcaggcccatcaccgccgactccgccctcatgaaccccaacacccgcatcctc
gccctcaaagctcaaatacctgggacaacacaggatcacctgcaaatcttcaacattgag
gctaaaacaaaaattaagtcccaccagatgcctgagcaggttgtgttttggaaatggatc
accccaaagttgttgggtttggtaacacaaacatcagtttatcactggtcaattgaggga
gattctgaaccggccaagatgttcgataggacggctaatttggccaacaatcaaattatc
aactatcgatgtgatccatctgagaagtggcttgtgcttattggaattgcacctggtgct
ccagagaggccacaactggtgaagggaaatatgcaacttttttctgtggatcagcaacgt
agtcaggcacttgaagcccatgcagcatcctttgcatcatttaaggtcgtgggcaacgag
aacccttcaactctcatctgctttgcctcaaagacaactaatgctgggcagatcacttct
aagttgcatgttattgaattgggtgcccagccagggaaaccagggttttccaagaagcaa
gctgatctcttcttccccccagattttcaggatgattttcctgtggccatgcagatctct
cagaagtatggccttatctatgtaattacgaagcttggccttttatttgtatatgacttg
gaaacagctgcagcggtctatagaaatagaattagtccagatcctatattcttgacagca
gagtcttctgcaagtggtggtttttatgccatcaataggagaggacaggttttacatgcc
acagttaatgatgcaaccattgtgccttttgtcagcagtcaattaaataaccttgaacta
gctgtaaatcttgccaaaagagctaatcttcctggggcagagaacttggttgtgcaaagg
tttcaagaattgtttgcacaaacaaaatacaaggaagcagctgagttggctgcagaatct
cctcaaggtcttctccgaactcctgatactgttgcaaaatttcagagtgttcctgttcaa
gctgggcaaacgcctccactcttgcagtactttggcacattgctaactcgggggaagctc
aatgcttacgagtctcttgagctatctcgacttgttgtcaatcagaacaaaaagaacctt
ttggaaaactggttggctgaagacaaattggagtgcagtgaagaacttggagatcttgtc
aagactgtggacaatgatcttgctctgaaaatatacataaaggctagggcaacccctaaa
gttgttgccgcttttgctgaaagaagggaatttgacaagatccttatatattcaaagcag
gttggatacacccctgactacctcttcctcctccagaccattttacgtacggatccacag
ggagctgtcaactttgcgctcatgatgtcacaaatggaggggggctgtccagttgattac
aatactataactgatctcttccttcagagaaacatgatacgtgaggcaacagctttcctg
ctggatgttttaaagccaaacttgccggagcatgcttttcttcaaaccaaggttttggag
atcaacttggtcacttacccaaatgttgctgatgccatccttgctaatggtatgttcagt
cattatgatcgccctcgtgttgctcagctttgtgaaaaggctggcttgtacttgcgagct
ctccagcattacacagaattaccagatatcaagcgtgtcatggtgaatacccatgccatt
gagccacaggcacttgttgagttctttggcactctttcaagagagtgggctttggagtgc
atgaaggaccttctgctggtcaatctaagagggaatcttcaaattgttgtacaggctgcc
aaagaatactctgagcagctaggggttgatgcttgcataaaactgtttgagcaattcaaa
tcttacgagggcctttactttttcttgggagcttatttgagttccagtgaggatccagat
attcatttcaaatacatagaagcagctgctaggactggacagatcaaagaagttgaacgt
gtaaccagggaatccaacttttatgatgcggagaagacaaagaactttttaatggaagcg
aaactgcctgatgcccgtccgctgattaatgtctgcgaccgctttggatttgttccagat
ttgacccactatctgtatacaaataatatgcttcggtatattgaaggctatgtacagaaa
gtgaaccctggaaatgctccattagttgttggacagctacttgatgatgagtgccctgaa
gatttcattaagggtttgattctgtctgtccgttctctccttcctgttgagccactagtt
gatgaatgcgagaagaggaaccgcctacggctgctgacacaatttttggagcacttagtg
agcgagggtagccaagatgtccatgtgcacaatgctcttggaaaaatcatcattgacagc
aacaataatcctgagcacttccttaccaccaatccattttatgactctcgcgtggtcggt
aaatactgtgaaaagcgggatcctacccttgctgttgttgcttacagacgtggacagtgt
gatgatgaacttattaatgtcaccaataaaaactcactgttcaagctgcaagctaggtat
gtggttgaaagaatggatggtgatctgtgggataaagttctacagcctgaaaatgaatat
agaaggcaactcattgaccaagtggtttctacggctttgcctgaaagcaagagccccgag
caagtgtctgctgccgttaaggctttcatgacagctgatcttccccatgaactgattgaa
cttcttgaaaagatcgtccttcaaaattctgctttcagtggaaacttcaatctgcagaac
cttctcatcttgacagccatcaaggctgacccatctagggtcatggactatgtcaacagg
ctggacaactttgatgggcctgctgttggagaagtagcagttgaagcacagctgtttgag
gaggctttcgctatcttcaagaagttcaacttaaatgtgcaggctgtcaatgttctattg
gacaacatccgaagcatagaaagagctgaagagtttgcattccgtgttgaagaagatgct
gtttggagccaggttgccaaggcccagttgcgtgaaggtttggttagtgaagcaattgag
tccttcattcgtgcagatgatgcaacacatttcctcgacgtcatccgtgctgctgaggaa
gctaatgtatacgatgatctagttaagtacttgcttatggtaaggcagaaggcaagggaa
cccaaagttgatggagaactcatctttgcgtatgctaagattgatagactcagtgatatt
gaagagttcattctcatgccaaatgttgccaatcttcaaaatgttggtgatcgtctgtat
gatgaagaactttatgaagcagcaaagatcatctatgccttcatctcaaactgggctaag
ctggctgttacccttgttaagctgaagcagttccaaggtgctgtggatgctgctcgcaag
gctaacagtgctaaaacatggaaggaagtctgctttgcttgtgttgatgccgaggagttc
cggctagcacaaatatgtggtctcaatattattgtccaggttgatgatttggaggaagta
agtgaatactaccagaacagaggatgtttcaatgaacttatttccctcatggaaagtggt
ctaggactggagcgtgctcacatgggcatcttcacagaattaggagtcctctatgctaga
tatcgccctgagaagctcatggaacatatcaaacttttctccacacgtctcaacattcct
aagcttatccgtgcttgtgatgaacagcagcactggaaagagcttacttacctatacatc
cagtatgatgaatttgacaatgctgccaccactattatgaaccattctccggatgcatgg
gatcatatgcaatttaaggatgttgctgttaaagttgcaaatgttgagctatactacaag
gcagtgcacttctatctgcaagagcatcctgatctcatcaatgaccttctcaatgtactc
gcgcttcgtttggatcatacaagagtcgtggacataatgcgcaaggctggtcagttgcat
cttgtgaaaccatacatggttgcagttcagagcaacaatgtctctgctgtgaatgaatct
ttgaatgagctttatgttgaagaggaggattatgagagactccgtgaatcggttgatatg
catgacaactttgatcagataggtcttgcccagaagcttgagaagcatgaattgcttgag
atgaggaggatcgctgcctacatttacaagaaggctggcagatggaagcaatctattgcc
ctgtcgaagaaagacaacatgtacaaggattgcatggagacatgctcacagtctggtgac
cgcgagctgtcagaagatttgcttgtctatttcattgaacagggaaagaaagaatgcttt
gcttcttgtctctttatttgttatgacttgatccgtgcggatgttgctcttgagcttgca
tggatgaacaacatggtggactttgcattcccctatctgttacagttcattcgggagtac
acaagcaaggttgatgagctagtgaaggacaggattgaatcacagaatgaagtaagggct
aaagagaaggaagaaaaagatcttgttgctcagcagaacatgtatgcccaattgcttcct
cttgccttgcctgctcctcctggtatgggcggtcctccaccgccaatggggatgccgggc
atgcctccgatgggcggaatggggatgcctccgatgggtcctggacctatgccagcatat
gggatgcctccaatgggaagctactga

DBGET integrated database retrieval system