KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349630
Entry
4349630           CDS       T01015                                 
Name
(RefSeq) bis(5'-adenosyl)-triphosphatase
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4349630
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     4349630
SSDB
Motif
Pfam: HIT DcpS_C
Other DBs
NCBI-GeneID: 4349630
NCBI-ProteinID: XP_015615283
UniProt: A0A0P0XY71
LinkDB
Position
11:905633..907843
AA seq 212 aa
MLPVLSADLRRAPTPFSLLPLALAPPPPPPPTLLRRRPLLLPRAISSSTSPPPVQEMEAA
YKFGPYKIDAREVFHSTPLSYAMVNLRPLLPGNVLVCPKREVKRFADLSSNEISDLWVTA
KEVGIRLEQYHKASSLTFAIQDGPQAGQTVPHVHIHVIPRKKGDFEKNDEIYDAIDVKER
ELKEKLDLDIERKDRTMKEMAHEANEYRGLFS
NT seq 639 nt   +upstreamnt  +downstreamnt
atgcttccggtgctctccgccgacctccgccgcgcgcccactcccttctcccttctccct
ctcgctctcgctccgccgccgccgccgcctcctacccttcttcggcgccggccactgctt
ctgccgcgagccatctcctcctctacctcgccgccgccggtccaggagatggaggcggct
tacaagttcgggccgtacaagatcgacgcgagggaggtgttccactccacgccgctgtcc
tacgccatggtcaacctccgcccactcctccctggtaatgttctagtgtgccccaagcgt
gaagtgaaacgatttgctgatctaagttctaatgagattagtgacttatgggttaccgca
aaggaagttggtatacggcttgaacagtaccacaaagcgtcttcacttacatttgctatt
caggatggtccacaagctggtcaaactgttccacatgtccacatccatgtcatccctaga
aagaaaggagattttgagaaaaatgatgagatatatgatgcgattgatgtcaaagagagg
gaattgaaggagaaacttgatctggacatagagagaaaagatagaaccatgaaagaaatg
gctcatgaggccaatgagtaccgtggtctcttctcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351353
Entry
4351353           CDS       T01015                                 
Name
(RefSeq) bis(5'-adenosyl)-triphosphatase
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4351353
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     4351353
SSDB
Motif
Pfam: HIT DcpS_C GalP_UDP_tr_C
Other DBs
NCBI-GeneID: 4351353
NCBI-ProteinID: XP_015620368
LinkDB
Position
12:964518..969276
AA seq 210 aa
MLPALSAVLRRAPTPFSLLPLPLAPPPPPTLLRRRPLLLPRAISSSSSPPPVQEMEAAYK
FGPYKIDAREVFHSTPLSYAMVNLRPLLPGNVLVCPKREVKRFADLSSNETSDLWVTAKE
VGVRLEQYHKASSLTFAIQDGPEAGQTVSHVHIHVIPRKKGDFEKNDEIYDAIDVKEREL
KEKLDLDIERKDRTMEEMAHEANEYRALFS
NT seq 633 nt   +upstreamnt  +downstreamnt
atgcttccggcgctctccgccgtcctccgccgcgcgcccactcccttctcccttctccct
ctccctctcgctccgcctccgcctcctacccttcttcgccgtcgtccactgcttctgccg
cgagccatctcctcctcttcctcgccgccgccggtccaggagatggaggcggcttacaag
ttcgggccgtacaagatcgacgcgagggaggtgttccactccaccccgctctcctacgcc
atggtcaacctccgcccactcctccctggtaatgttctagtgtgccccaagcgtgaagtg
aaacgatttgctgatctaagttctaatgagactagtgacttatgggttaccgcaaaggaa
gttggtgtacggcttgagcagtaccacaaagcgtcttcacttacatttgctattcaggat
ggtccagaagctggtcaaactgtttcacatgtccacatccatgtcatccctagaaagaaa
ggagattttgagaaaaatgatgagatatatgatgcgattgatgtcaaagagagggaattg
aaggagaaacttgatctggacatagagagaaaagatagaaccatggaagaaatggctcat
gaggccaatgagtaccgtgctctcttctcttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351354
Entry
4351354           CDS       T01015                                 
Name
(RefSeq) bis(5'-adenosyl)-triphosphatase
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4351354
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     4351354
SSDB
Motif
Pfam: HIT DcpS_C DUF4931
Other DBs
NCBI-GeneID: 4351354
NCBI-ProteinID: XP_015620369
LinkDB
Position
12:971160..975968
AA seq 156 aa
MDPVAGSRYRFGPHEIAERQVFRTSPLSFAIVNLRPTRPGHVLICPKSLVKLFADLSPDE
TRDLWIMAKDIGVRVEQYQRASSLTFTIQDGPHSGQTVPHVHVHIVPRRKEDFENNDNNN
GMMNAKNETLDLDIERKDRTMEEMAQEAKEYRALFS
NT seq 471 nt   +upstreamnt  +downstreamnt
atggatccggtcgcgggaagcaggtacaggtttggtccgcacgagatagccgagcggcag
gtgttccgcacctcgcccctctccttcgccatcgtcaacctccgacccacccgccctggt
catgttcttatatgcccaaagagtcttgtgaaactatttgctgatcttagccctgatgag
actcgtgatttgtggatcatggcaaaggatattggtgtacgtgttgagcagtaccagagg
gcttcttcgctcacattcacaattcaggacggacctcactctggccaaacagttccacat
gttcacgttcacatcgttccccgaaggaaggaagattttgagaacaatgataacaataat
ggcatgatgaatgcaaaaaacgagacattagacctggatattgaaagaaaagatagaacg
atggaagaaatggcccaagaagccaaagaatatcgtgctcttttctcctag

DBGET integrated database retrieval system