KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349745
Entry
4349745           CDS       T01015                                 
Name
(RefSeq) 2-isopropylmalate synthase A
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00290  Valine, leucine and isoleucine biosynthesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4349745
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    4349745
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     4349745
SSDB
Motif
Pfam: HMGL-like LeuA_dimer
Other DBs
NCBI-GeneID: 4349745
NCBI-ProteinID: XP_015616654
UniProt: Q2RAP8 A0A8J8XUE9
LinkDB
Position
11:1989182..1995090
AA seq 635 aa
MASSLLSSPKPSSFSSANPTSTPRPRAQTLSPFRAAAPRFSHGLATAAAAANPSASRRCY
HRAFARPVRASMAQPRRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQ
LARLGVDIIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAW
EAVRHARRPRIHTFIATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAG
RSNREFLYHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQ
NDLGLATANTLAGAHAGARQLEVTINGIGERAGNASLEEVVMAIKCRRELLGGLYTGINT
QHITMSSKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTR
ANEFGIVLGKLSGRHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLS
DEIFQPKVFWSLADVQATCGTLGLSTATVKLIGPDGEEKIACAVGTGPVDAAYKAVDDII
QIPTVLREYSMTSVTEGIDAIATTRVVVTGDVSDSKHALTGHSFSRAFSGSGAALDIVVS
SVRAYLSALNKMSSFVGAIKASSEVSESQRVQTTE
NT seq 1908 nt   +upstreamnt  +downstreamnt
atggcctcctccctcctctcctccccaaaaccctcctccttctcctccgcaaaccccacc
tccactccacgcccacgcgcccaaactctctcccccttccgcgccgccgccccacgcttc
tcccatggcctcgccaccgccgccgccgccgcaaaccctagcgcctcccgccgctgctac
caccgcgccttcgcccgccccgtccgggcgtccatggcgcagccgcggcgcccggagtac
gtccccaaccgcatcgacgaccccaactacgtccgcatcttcgacaccaccctccgcgac
ggggagcagtcccccggggccaccatgaccagcgccgagaagctcgtcgtcgcgcgccag
ctcgcccgcctcggcgtcgacatcatcgaggccgggttcccggcctcctcccccgacgac
ctcgacgccgtgcgctccatcgccatcgaggtcgggaacacgcccgtcggggaggacggc
cacgtgccggtcatctgtggcctctcgagatgcaataagcgagacattgatgctgcctgg
gaggccgtgcggcacgcgcggcggccgcgcatccacaccttcattgccaccagcgagatc
catatgcagcacaagctaaggaagacgcccgagcaggtggtggccattgccaaggaaatg
gtggcctacgcccgcagcctaggctgccctgatgtcgagttcagccctgaagacgctggc
aggtcaaacagagagtttctatatcatattctagaggaagtcataaaagctggagcaaca
acactcaatatcccagacactgttggatacactcttccttatgaatttgggaagctaatt
gctgatataaaagcaaacactccaggaattgaaaatgctattatttctactcattgccag
aatgaccttggtctagcaaccgccaatacattagcgggcgctcatgcaggagcacggcaa
ttagaggtgactatcaacggtattggtgaaagggctggaaatgcttctttggaagaggtt
gtgatggcaattaaatgtcgccgagagctcttaggaggtctgtatactggaatcaatacc
caacatatcactatgtcaagcaaaatggtacaagagcacagtggacttcatgtacaacca
cataaagctattgtcggtgccaatgcctttgcacatgaaagtggaattcatcaggatggg
atgcttaaatacaaaggaacttatgaaataatttctcctgatgatattggtctaacacgt
gcaaacgagtttggtattgttcttgggaaactcagtggaaggcatgctgtgagatctaaa
ctagtggagcttggatatgaaatcactgacaaggaatttgaggatttctttaaacgctac
aaagaggttgcagagaagaaaaagcgtgtaactgatgaagacattgaggcgctgttgtct
gatgagatatttcagcccaaggttttttggtcccttgctgatgtacaggcaacttgtgga
acacttggtctgtctacagcaactgtcaaactgataggtccggatggagaggagaagatt
gcatgtgcagttggaacaggtccagttgatgcagcttacaaggctgttgatgatataata
cagatcccaactgttcttcgagaatatagcatgacatcggtcacagaaggcattgatgca
attgcaactactagagtggttgtcactggagatgttagcgactctaaacatgctttgact
ggtcactccttcagccgggcattcagtgggagtggtgccgcactggatattgttgtttcc
agtgtgcgagcttacctgagtgccctgaacaagatgtccagttttgttggggctatcaag
gctagtagtgaagtatctgaaagccaaagagttcaaaccacagaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351460
Entry
4351460           CDS       T01015                                 
Name
(RefSeq) 2-isopropylmalate synthase A
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00290  Valine, leucine and isoleucine biosynthesis
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4351460
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    4351460
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     4351460
SSDB
Motif
Pfam: HMGL-like LeuA_dimer
Other DBs
NCBI-GeneID: 4351460
NCBI-ProteinID: XP_015619620
UniProt: Q2QXY9 A0A8J8XWU7
LinkDB
Position
12:1888937..1894908
AA seq 635 aa
MASSLLSSPKPSSFSSANPTSTPRPRAQTLSPFRAAAPRFSHGLATAAAAANPSASRRCY
HRAFARPVRASMAQPRRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTSAEKLVVARQ
LARLGVDIIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRCNKRDIDAAW
EAVRHARRPRIHTFIATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPDVEFSPEDAG
RSNREFLYHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIENAIISTHCQ
NDLGLATANTLAGAHAGARQLEVTINGIGERAGNASLEEVVMAIKCRRELLGGLYTGINT
QHITMSSKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEIISPDDIGLTR
ANEFGIVLGKLSGRHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVTDEDIEALLS
DEIFQPKVFWSLADVQATCGTLGLSTATVKLIGPDGDEKIACAVGTGPVDAAYKAVDDII
QIPTVLREYSMTSVTEGIDAIATTRVVVTGDVSDSKHALTGHSFNRAFSGSGAALDIVVS
SVRAYLSALNKMSSFVGAIKASSEVSESQRVQTTE
NT seq 1908 nt   +upstreamnt  +downstreamnt
atggcctcctccctcctctcctccccaaaaccctcctccttctcctccgcaaaccccacc
tccactccacgcccacgcgcccaaactctctcccccttccgcgccgccgccccacgcttc
tcccatggcctcgccaccgccgccgccgccgcaaaccctagcgcctcccgccgctgctac
caccgcgccttcgcccgccccgtccgggcgtccatggcgcagccgcggcgcccggagtac
gtccccaaccgcatcgacgaccccaactacgtccgcatcttcgacaccaccctccgcgac
ggggagcagtcccccggggccaccatgaccagcgccgagaagctcgtcgtcgcgcgccag
ctcgcccgcctcggcgtcgacatcatcgaggccgggttcccggcctcctcccccgacgac
ctcgacgccgtgcgctccatcgccatcgaggtcgggaacacgcccgtcggggaggacggc
cacgtgccggtcatctgtggcctctcgagatgcaataagcgagacattgatgctgcctgg
gaggccgtgcggcacgcgcggcggccgcgcatccacaccttcattgccaccagcgagatc
catatgcagcacaagctaaggaagacgcccgagcaggtggtggccattgccaaggaaatg
gtggcctacgcccgcagcctaggctgccctgatgtcgagttcagccctgaagacgctggc
aggtcaaacagagagtttctatatcatatactagaggaagtcataaaagctggagcaaca
acactcaatatcccagacactgttggatacactcttccttatgaatttgggaaactaatt
gctgatataaaagcaaacactccaggaattgaaaatgccattatttctactcattgccag
aatgaccttggtctagcaaccgcaaatacattagcgggcgctcatgcaggagcacggcaa
ttagaggtgactatcaatggtattggtgaaagggctggaaatgcttctttggaagaggtt
gtgatggcaattaaatgtcgtcgagaactcttaggaggtctgtatactggaatcaatacc
caacatatcactatgtcaagcaaaatggtacaagagcacagtggacttcatgtacaacca
cataaagctattgtcggtgccaatgcctttgcacatgaaagtggaattcatcaggatggg
atgcttaagtacaaaggaacttatgaaataatttctcctgatgatattggtctaacacgt
gcaaatgagtttggtattgttcttgggaagctcagtggaaggcatgctgtgagatctaaa
ctagtggagcttggatatgaaatcactgacaaggaatttgaggatttctttaaacgctac
aaagaggttgcagagaagaaaaagcgtgtaactgatgaagacattgaggcgctgttgtct
gatgagatatttcagcccaaggttttttggtcccttgctgatgtacaggcaacttgtgga
acacttggtctgtctacagcaactgtcaaactgataggtccggatggagatgagaagatt
gcatgtgcagttggaacaggtccagttgatgcagcttacaaggctgttgatgatataata
cagatcccaactgttcttcgagaatatagcatgacatcggtcacagaaggcattgatgca
attgcaactactagagtggttgtcactggagatgtcagcgactctaaacatgctttgact
ggtcactccttcaaccgggcattcagtgggagtggtgccgcactggatattgttgtttcc
agtgtgcgagcttacctgagtgccctgaacaagatgtccagttttgttggggctatcaag
gctagtagtgaagtatctgaaagccaaagagttcaaaccacagaatga

DBGET integrated database retrieval system