KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349746
Entry
4349746           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 90A1
  KO
K09588  3beta,22alpha-dihydroxysteroid 3-dehydrogenase [EC:1.14.19.79]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    4349746
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4349746
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.79  3beta,22alpha-dihydroxysteroid 3-dehydrogenase
     4349746
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP90 family
   4349746
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4349746
NCBI-ProteinID: XP_015616657
UniProt: Q2RAP4
LinkDB
Position
11:complement(2006844..2010140)
AA seq 501 aa
MAAAALLLLAAAAAIVVVAMVLRWLLLLGGPAAGRLGKRALMPPGSTGLPLIGETLRLIS
AYKTPNPEPFIDERVARHGGVFTTHVFGERTVFSADPAFNRLLLAAEGRAVHSSYPSSIA
TLLGARSLLLTRGAAHKRLHSLTLTRLGRPASPPLLAHIDRLVLATMRQWEPAATVRLMD
EAKKITFNLTVKQLVSIEPGPWTESLRREYVKLIDGFFSIPFPLANLLPFTTYGQALKAR
KKVAGALREVIKKRMEEKAENGGSIGDDEGKKEKKDMVEELLEAEGGSFSEEEMVDFCLS
LLVAGYETTSMLMTLAVKFLTETPAALAELKEEHANIRDMKGKKQPLEWSDYKSMPFTQC
VINETLRVGNIISGVFRRANTDIHYKDYTIPKGCKIFASFRAVHLNNEHYENARTFNPWR
WQINNKLQNAVGANIFTPFGGGPRLCPGYELARVVVSIFLHHLVTRFSWEETEEDRLVFF
PTTRTLKGYPINLRLLSESIC
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggccgcggccgcgctgctcctcctcgccgcggccgccgccatcgtcgtggttgccatg
gtgctcagatggctcctcctcctcgggggccccgccgccgggaggctggggaagagggcg
ctgatgccgccggggagcacgggcctgccgctgattggcgagacgctgcggctcatctcg
gcgtacaagacgcccaacccggagccgttcatcgacgagcgcgtggcgcgccacggcggc
gtgttcaccacccacgtcttcggcgagcgcaccgtgttctccgccgacccggccttcaac
cgcctcctcctcgccgccgagggccgcgccgtccactccagctacccgtcctccatcgcc
acgctcctcggcgcgcgctccctgctcctcacccgcggcgccgcgcacaagcggctccac
tccctcaccctcacccgcctcggccgccccgcgtcgccgcccctcctcgcgcacatcgac
cgcctcgtgctcgccaccatgcgccagtgggagcccgccgccaccgtgcgcctcatggac
gaggccaagaaaatcaccttcaacctcaccgtcaagcagctcgtcagcatcgagccggga
ccgtggaccgagagcctccgccgcgagtacgtcaagctcatcgacggcttcttctccatc
ccctttcctctcgccaacctcctcccttttaccacctacggccaggccctcaaggcgagg
aagaaggtggccggtgcactgcgggaggtgataaagaagaggatggaggagaaagcggag
aatggtggctccattggggatgatgaggggaagaaggagaagaaggacatggttgaggag
cttcttgaggcggagggtggcagcttctcggaggaagagatggtggatttctgcctttct
ctgctggtggctgggtatgagactacgtccatgctcatgacgctcgcggtcaagttcctc
actgagacgcctgctgcgctagctgagctcaaggaagagcatgccaatatcagggatatg
aaagggaaaaaacaaccactagagtggagcgattacaagtccatgccatttactcaatgt
gtgataaatgagacactccgtgtgggtaacattattagtggagtattcaggcgagcaaac
actgatattcattataaagattacacaattccaaagggatgcaagatttttgcttcattc
cgagctgtgcaccttaataatgaacactacgagaatgctcggacatttaacccttggaga
tggcagatcaacaataaacttcagaatgcggtaggggccaatatatttactccatttggc
ggtggaccccggttgtgtcctggctatgagcttgcccgggttgtcgtttctatcttcctc
catcatcttgtaacgcgctttagctgggaagaaaccgaagaagatagacttgtcttcttc
cccaccacacgaactctcaaaggataccctatcaatcttcggctgctttcagaatcaatt
tgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351461
Entry
4351461           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 90A1
  KO
K09588  3beta,22alpha-dihydroxysteroid 3-dehydrogenase [EC:1.14.19.79]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00905  Brassinosteroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    4351461
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4351461
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.79  3beta,22alpha-dihydroxysteroid 3-dehydrogenase
     4351461
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP90 family
   4351461
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4351461
NCBI-ProteinID: XP_015619622
UniProt: Q5CCK1
LinkDB
Position
12:complement(1905817..1909258)
AA seq 501 aa
MAAAALLLLAAAAAAVVVAMALRWLLLLGGPAAGRLGKRARMPPGSTGLPLIGETLRLIS
AYKTPNPEPFIDERVARHGGVFTTHVFGERTVFSADPAFNRLLLAAEGRAVHSSYPSSIA
TLLGARSLLLTRGAAHKRLHSLTLTRLGRPASPPLLAHIDRLVLATMRQWEPAATVRLMD
EAKKITFNLTVKQLVSIEPGPWTESLRREYVKLIDGFFSIPFPLAYFLPFTTYGQALKAR
KKVAGALREVIKKRMEEKAENGGSIGDDEGKKEKKDMVEELLQAEGGSFSEEEMVDFCLS
LLVAGYETTSVLMTLAVKFLTETPAALAELKEEHANIRDMKGKNQPLEWSDYKSMPFTQC
VINETLRVGNIISGVFRRANTDIHYKDYTIPKGCKIFASFRAVHLNNEHYENARTFNPWR
WQINNKLQNAVGANIFTPFGGGPRLCPGYELARVVVSIFLHHLVTRFSWEETEEDRLVFF
PTTRTLKGYPINLRLLSESIC
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggccgcggccgcgctgctcctcctcgccgcggccgccgccgccgtcgtggttgccatg
gcgctcagatggctcctcctcctcgggggccccgccgccgggaggctggggaagagggcg
cggatgccgccggggagcacgggcctgcctctgattggcgagacgctgcggctcatctcg
gcgtacaagacgcccaacccggagccgttcatcgacgagcgcgtggcgcgccacggcggc
gtgttcaccacccacgtcttcggcgagcgcaccgtgttctccgccgacccggccttcaac
cgcctcctcctcgccgccgagggccgcgccgtccactccagctacccgtcctccatcgcc
acgctcctcggcgcgcgctccctgctcctcacccgcggcgccgcgcacaagcggctccac
tccctcaccctcacccgcctcggccgccccgcgtcgccgcccctcctcgcgcacatcgac
cgcctcgtgctcgccaccatgcgccagtgggagcccgccgccaccgtccgcctcatggac
gaggccaagaagatcaccttcaacctcaccgtcaagcagctcgtcagcatcgagccggga
ccgtggaccgagagcctccgccgcgagtacgtcaagctcatcgacggcttcttctccatc
ccctttcctctcgcctacttcctcccttttaccacctacggccaggccctcaaggcgagg
aagaaggtggccggtgcactgcgggaggtgataaagaagaggatggaggagaaagcggag
aatggtggctccattggggatgatgaggggaagaaggagaagaaggacatggtggaggag
cttcttcaggcggagggtggcagcttctcggaggaagagatggtggatttctgcctttct
ctgctggtggctgggtatgagactacgtccgtgctcatgacgctcgcggtcaagttcctc
actgagacgcctgctgcgctagctgagctcaaggaagagcatgccaatatcagggatatg
aaagggaaaaaccaaccattagagtggagcgattacaagtccatgccatttactcaatgt
gtgataaatgagacactccgtgtgggtaacattattagtggagtattcaggcgagcaaac
actgatattcattataaagattacacaattccaaagggatgcaagatttttgcttcattc
cgagctgtgcaccttaataatgaacactacgagaatgctcggacatttaacccttggaga
tggcagatcaacaataaacttcagaatgcggtaggggccaatatatttactccatttggt
ggtggacctcggttgtgtcctggctatgagcttgcccgggttgtcgtttctatcttcctc
catcatcttgtaacgcgctttagctgggaagaaaccgaagaagatagacttgtcttcttc
cccaccacacgaactctcaaaggataccctatcaatcttcggctgctttcagaatcaatt
tgctga

DBGET integrated database retrieval system