KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349749
Entry
4349749           CDS       T01015                                 
Name
(RefSeq) L-galactono-1,4-lactone dehydrogenase 1, mitochondrial
  KO
K00225  L-galactono-1,4-lactone dehydrogenase [EC:1.3.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00114  Ascorbate biosynthesis, plants, fructose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4349749
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.2  With a cytochrome as acceptor
    1.3.2.3  L-galactonolactone dehydrogenase
     4349749
SSDB
Motif
Pfam: FAD_binding_4 ALO
Other DBs
NCBI-GeneID: 4349749
NCBI-ProteinID: XP_015616655
UniProt: Q2RAP0
LinkDB
Position
11:complement(2019763..2024242)
AA seq 583 aa
MRRLLLAGILRRASSSPSSHHHLHLVRALSASSPLPASDADLRKYAGYALLLLGCGAATY
YSFPLPPDALHKKAVPFKYAPLPDDLHAVSNWSATHEVHTRVLLQPDSLPALHDALAAAH
GECRKLRPLGSGLSPNGLALSRAGMVNLALMDKVLGVDAKKKTVTVQAGIRVAELVDALR
EHGLTLQNFASIREQQVGGIIQVGAHGTGARLPPIDEQVISMKLVTPAKGTIELSREKDP
DLFYLARCGLGGLGVVAEVTLQCVERHQLIEHTFVSNADEVKKNHKKWLSENKHIKYLWI
PYTDTVVVVQCNPPSRWRTPKFTSKYGKDEAIQHVRDLYHESLKKYRTKAESNDPEVDQL
SFTELRDRLLTLDPLDKDHVIRINKAEAEYWKKSEGYRMGWSDEILGFDCGGQQWVSETC
FPAGTLAKPNMKDLDYIEELLQLIEKEDIPAPAPIEQRWTACSRSPMSPASSSQEDDIFS
WVGIIMYLPTSDARQRKEITEEFFNYRSKTQTNLWDGYSAYEHWAKIEVPKDKDELAELQ
ARLRKRFPVDAYNKARMELDPNKVLSNAKLEKLFPVTEVQHEK
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgcggcgcctcctcctcgccggcatcctccgccgcgcctcctcctccccttcctcccac
caccacctccaccttgtcagggcgctctccgcctcgtccccgctcccggcctccgacgcc
gacctccgcaagtacgccggctacgcgctcctcctcctcggctgcggcgccgccacctac
tactccttcccgcttccccccgacgcgctccacaagaaggccgtccccttcaagtacgcg
ccgctccccgacgacctccacgccgtctccaactggagcgccacccacgaggtccacacc
cgcgtcctcctccagcccgactccctccccgccctccacgacgcgctcgccgccgcccac
ggcgagtgccgcaagctcaggcccctcggctcgggcctgtcccccaatggcctcgcgctc
tcccgcgccggcatggtcaacctcgcgctcatggacaaggtgctcggcgtcgacgccaag
aagaagaccgtcaccgtgcaggccgggatacgcgtcgccgagcttgtcgacgcgctccgg
gagcatggtctcacgctgcagaacttcgcgtccattcgggagcagcaggtcggcggcatc
attcaggttggtgcccatggcactggtgcaagattgccaccaattgatgaacaagttatt
agcatgaaattggttacccctgccaaggggacaatagagttgtcaagggagaaggatcct
gatttattctatcttgctcgctgtggacttggtggccttggagttgtagcagaagttact
cttcaatgtgtggaaagacaccaacttattgaacacactttcgtttccaatgcagacgaa
gtcaagaaaaatcacaagaaatggctctctgaaaataaacatattaagtacttatggatt
ccatacaccgatacagttgttgttgtccaatgcaatcctccttcaaggtggagaactcca
aagtttacctcaaaatatggaaaggatgaggctatacaacatgttcgtgatctttatcat
gagtcattgaagaaatatagaactaaagcagaaagtaatgacccagaagtagatcagctt
tcattcactgaattgagggatcggttgcttaccctggatcctctagacaaagatcatgtg
atcagaattaacaaagcagaagctgaatattggaagaagtcagagggttatcgcatgggc
tggagtgacgaaatattaggctttgattgtggtgggcagcagtgggtttctgaaacttgc
ttccctgcagggaccctagcaaagcctaatatgaaggatctggattatatagaggagctg
ctgcagttgattgagaaggaagatatacccgcaccggcacctattgagcagcgttggact
gcctgcagcaggagtcccatgagcccagcatcaagctctcaagaagatgacatattttca
tgggttgggataataatgtacctcccaacgtcggatgctcgccaaaggaaggaaattaca
gaggaattttttaattacagaagtaagacgcaaacaaatctatgggatggttattctgca
tatgaacactgggccaaaattgaggttcctaaggataaggatgaactcgctgaactccag
gctaggttgaggaaacgtttcccagtagatgcatataacaaagcacgcatggagcttgac
cctaacaaggttctttccaatgcaaagttagagaagctcttcccagtaacagaggtccaa
catgaaaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351464
Entry
4351464           CDS       T01015                                 
Name
(RefSeq) L-galactono-1,4-lactone dehydrogenase 2, mitochondrial
  KO
K00225  L-galactono-1,4-lactone dehydrogenase [EC:1.3.2.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00114  Ascorbate biosynthesis, plants, fructose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4351464
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.2  With a cytochrome as acceptor
    1.3.2.3  L-galactonolactone dehydrogenase
     4351464
SSDB
Motif
Pfam: FAD_binding_4 ALO
Other DBs
NCBI-GeneID: 4351464
NCBI-ProteinID: XP_015619621
UniProt: Q2QXY1
LinkDB
Position
12:complement(1922241..1926710)
AA seq 583 aa
MRRLLLAGILRRASSSPSSHHHLHLVRALSASSPLPASDADLRKYAGYALLLLGCGAATY
YSFPLPPDALHKKAVPFKYAPLPDDLHAVSNWSATHEVHTRVLLQPDSLPVLHDALAAAH
GERRKLRPLGSGLSPNGLALSRAGMVNLALMDKVLDVDAKKKTVTVQAGIRVAELVDTLR
EHGLTLQNFASIREQQVGGIIQVGAHGTGARLPPIDEQVISMKLVTPAKGTIELSREKDP
DLFYLARCGLGGLGVVAEVTLQCVERHQLIEHTFVSSADEVKKNHKKWLSENKHIKYLWI
PYTDTVVVVQCNPPSRWRTPKFTSKYGKDEAIQHVRDLYRESLKKYRTKAESNDPEVDQL
SFTELRDRLLALDPLDKDHVIRINKAEAEYWKKSEGYRMGWSDEILGFDCGGQQWVSETC
FPAGTLAKPNMKDLDYIEELLQLIEKEDIPAPAPIEQRWTACSRSPMSPASSSQEDDIFS
WVGIIMYLPTSDARQRKEITEEFFNYRSKTQTNLWDGYSAYEHWAKIEVPKDKDELTELL
ARLRKRFPVDAYNKARMELDPNKVLSNAKLEKLFPVTEVQHVK
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgcggcgcctcctcctcgccggcatcctccgccgcgcctcctcctccccttcctcccac
caccacctccacctcgtcagggcgctctctgcctcgtccccgctcccggcctccgatgcc
gacctccgcaagtacgccggctacgcgctcctcctcctaggctgcggcgccgccacctac
tactccttcccgcttccccccgacgcgctccacaagaaggccgtccccttcaagtacgcg
ccgctccccgacgacctccacgccgtctccaactggagcgccacccacgaggtccacacc
cgcgtcctcctccagcccgactccctccccgtcctccacgacgcgctcgccgccgcccac
ggcgagcgccgcaagctcaggcccctcggctcgggcctgtcccccaatggcctcgcgctc
tcacgcgccggcatggtcaacctcgcgctcatggacaaggtgctcgacgtcgacgccaag
aagaagaccgtcaccgtgcaggccgggatacgcgtcgccgagcttgtcgacacgctccgg
gagcatggcctcacgctgcagaacttcgcgtccattcgggagcagcaggtcggcggcatc
attcaggttggtgcccatggcactggtgcaaggttgccaccaattgacgaacaagttatt
agcatgaaattggttacccctgccaaggggacaatagagttgtcaagggagaaggatcct
gatttattctatcttgctcgctgtgggcttggtggccttggagttgtagcagaagttact
cttcaatgtgtggaaagacaccaacttattgaacacactttcgtttccagtgcagatgaa
gtcaagaaaaatcacaagaaatggctctctgaaaataaacatattaagtacttatggatt
ccatacaccgatacagttgttgttgtccaatgcaatcctccttcaaggtggagaactcca
aagtttacctcaaaatatggaaaggatgaggctatccaacatgttcgtgatctttatcgt
gagtcattgaagaaatatagaactaaagcagaaagtaatgacccagaagtagatcagctt
tcattcactgaattgagggatcggttgcttgccctggatcctctagacaaagatcatgtg
atcagaattaacaaagcagaagctgaatattggaagaagtcagagggctatcgcatgggc
tggagtgatgaaatattaggctttgattgtggtgggcagcagtgggtttctgaaacctgc
ttccctgcagggaccctagcaaagcctaatatgaaggatctggattatatagaggagctg
ctgcagttgattgagaaggaagatatacccgcaccggcacctattgagcagcgttggact
gcctgcagcaggagtcccatgagcccagcatcaagctctcaagaagatgacatattttca
tgggttgggataataatgtacctcccaacgtcggatgctcgacaaaggaaggaaattaca
gaggaattttttaattacagaagtaagacgcaaacaaatctgtgggatggttattctgca
tatgaacactgggccaaaattgaggttccgaaggataaggatgaactcactgaactcctg
gctaggttgaggaaacgtttcccagtagatgcatataacaaagcacgcatggagcttgac
cctaacaaggttctttccaatgcaaagttagagaagctcttcccagtaacagaggtccaa
catgtaaagtaa

DBGET integrated database retrieval system